Thailand - H1N1 - 153 deaths

[FrenchieGirl]

Public Health confirms suspect case of swine flu detected in Thailand

Thailand-Today.com
Breaking news and news headlines from Thailand in one place
www.Thailand-Today.com

Public Health permanent secretary Prat Boonyawongwiroj confirmed Saturday that a suspect case of Influenza A(H1N1) has been detected in Thailand.

He said the person is under quarantine and has been healed from the illness.

The Public Health Ministry has request a test by the a US lab to confirm the finding, Prat said.

The Nation

 

[pablomorgan]

Re: Thailand - One H1N1 suspect

Re: Thailand - One H1N1 suspect

http://nationmultimedia.com/2009/05/10/national/national_30102302.php

 

[Laidback Al]

Re: Thailand - One H1N1 suspect

Re: Thailand - One H1N1 suspect

One patient suspected of contracting H1N1 virus: Health Ministry

BANGKOK, May 9 (TNA) ? Of 10 patients now under close surveillance by Thailand?s Public Health Ministry suspected of contracting the deadly influenza A (H1N1), one is expected to have fallen victim to the disease, Minister Witthaya Kaewparadai announced on Saturday.
Without disclosing the identity of the patient -- in line with an agreement reached during a two-day meeting between public health ministers of the 10-member Association of Southeast Asian Nations along with China, Japan and South Korea, ended in Bangkok on Friday, Mr. Witthaya said the suspected victim had returned to Thailand from an area which was hit by the flu virus recently.

Medical laboratory tests showed that the person contracted the disease but confirmation cannot be made so the tests were sent to the US Centers for Disease Control and Prevention (CDC) on Thursday night for affirmation and it is expected that the result would be known within one week, Mr. Witthaya said.

Meanwhile, a spokesman for the Ministry?s Disease Control Department said the condition of the suspected patient is now improving after taking the antiviral drug Oseltamivir but is still under ?close supervision? of doctors.

Family members of the suspected victim are also under special care and observation of the ministry officials, the spokesman added. (TNA)

http://enews.mcot.net/view.php?id=9853

 

[HenryN]

Re: Thailand - One H1N1 suspect

Re: Thailand - One H1N1 suspect

One patient suspected of contracting H1N1 virus: Health Ministry


Medical laboratory tests showed that the person contracted the disease but confirmation cannot be made so the tests were sent to the US Centers for Disease Control and Prevention (CDC) on Thursday night for affirmation and it is expected that the result would be known within one week, Mr. Witthaya said.


http://enews.mcot.net/view.php?id=9853

This is utter nonsense. The sequence was at Genbank on May 9:

Submitted (09-MAY-2009) National Influenza Center, Department of
Medical Sciences, 88/7 Ministry of Public Health Tiwanon Rd.,
Muang, Nonthaburi 11000, Thailand

 

[HenryN]

Re: Thailand - One H1N1 suspect

Re: Thailand - One H1N1 suspect

LOCUS GQ132184 284 bp cRNA linear VRL 09-MAY-2009
DEFINITION Influenza A virus (A/Nonthaburi/102/2009(H1N1)) segment 4
hemagglutinin (HA) gene, partial cds.
ACCESSION GQ132184
VERSION GQ132184.1 GI:229892685
DBLINK Project:37813
KEYWORDS .
SOURCE Influenza A virus (A/Nonthaburi/102/2009(H1N1))
ORGANISM Influenza A virus (A/Nonthaburi/102/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 284)
AUTHORS de Silva,J.W., Lukebua,A., Waicharoen,S. and Chitakanpitch,M.
TITLE First 2009 H1N1 Influenza (Swine Flu) Isolate from Thailand
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 284)
AUTHORS de Silva,J.W., Lukebua,A., Waicharoen,S. and Chitakanpitch,M.
TITLE Direct Submission
JOURNAL Submitted (09-MAY-2009) National Influenza Center, Department of
Medical Sciences, 88/7 Ministry of Public Health Tiwanon Rd.,
Muang, Nonthaburi 11000, Thailand
COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009.
FEATURES Location/Qualifiers
source 1..284
/organism="Influenza A virus
(A/Nonthaburi/102/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/Nonthaburi/102/2009"
/serotype="H1N1"
/host="Homo sapiens"
/db_xref="taxon:644373"
/segment="4"
/country="Thailand"
/collection_date="2009"
/note="passaged in MDCK cells"
gene <1..>284
/gene="HA"
CDS <1..>284
/gene="HA"
/codon_start=2
/product="hemagglutinin"
/protein_id="ACQ89893.1"
/db_xref="GI:229892686"
/translation="SSDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKST
KLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSG"
ORIGIN
1 cagttcagat acaccagtcc acgattgcaa tacaacttgt cagacaccca agggtgctat
61 aaacaccagc ctcccatttc agaatataca tccgatcaca attggaaaat gtccaaaata
121 tgtaaaaagc acaaaattga gactggccac aggattgagg aatgtcccgt ctattcaatc
181 tagaggccta tttggggcca ttgccggttt cattgaaggg gggtggacag ggatggtaga
241 tggatggtac ggttatcacc atcaaaatga gcaggggtca ggat

 

[HenryN]

Re: Thailand - One H1N1 suspect

Re: Thailand - One H1N1 suspect

One patient suspected of contracting H1N1 virus: Health Ministry

BANGKOK, May 9 (TNA) –
Medical laboratory tests showed that the person contracted the disease but confirmation cannot be made so the tests were sent to the US Centers for Disease Control and Prevention (CDC) on Thursday night for affirmation and it is expected that the result would be known within one week, Mr. Witthaya said.

http://enews.mcot.net/view.php?id=9853

Anyone that has internet access and can copy and paste can confirm that the Thai H1N1 sequence at Genbank on May 9, A/Nonthaburi/102/2009(H1N1), was H1N1 swine flu

http://www.flutrackers.com/forum/showpost.php?p=231595&postcount=2

 

[Laidback Al]

Re: Thailand - One H1N1 suspect

Re: Thailand - One H1N1 suspect

Sunday, May 10, 2009

Swine Flu case reported in Bangkok​

PHUKET: The Public Health Ministry said yesterday it had detected a suspected first case of the deadly type A (H1N1) influenza in Thailand and is awaiting confirmation of the infection from the Center for Disease Control (CDC) in the United States. The result of the CDC's tests are expected within seven days.

No suspected cases of the type A (H1N1) virus have been found in Phuket or elsewhere in Thailand.

Public Health Minister Witthaya Kaewparadai told a press conference that monitoring by the Epidemiology Bureau in Bangkok had found 25 suspects from April 28 to Friday, most of whom had traveled to countries with outbreaks of the flu, and 15 of whom had been cleared. Ten remain in quarantine pending lab confirmation, he said.

One is suspected to have had A (H1N1), having returned from an outbreak country, but has recovered, Wittaya said. The ministry has already submitted that person's sample to the US CDC lab because Thailand has no sample of the A (H1N1) virus to compare with for confirmation, he said.

Declining to give details of the suspect, Wittaya affirmed that the ministry had everything under control with strict measures in place to prevent the virus spreading.

Chulalongkorn University virologist Yong Poovorawan applauded the ministry's submission of the sample to the CDC, as this was Thailand's first suspected case.

Dr Rungrueng Kitphati, chief of the Medical Science Department's International Health Regulation Coordination Centre, noted that samples had been sent abroad in the same way during the Sars and bird-flu scares.

The Thai Disease Control Department's spokesman, Dr Kamnuan Ungchusak, said the patient's samples had been sent to the US on Thursday evening.

The patient, who was well informed about the situation, had a fever on arrival in Thailand and had taken the antiviral drug Oseltamivir for five days until recovering, he added.

The ministry has been screening arrivals, especially from Mexico, the US, Canada, Spain and the UK, at Bangkok's Suvarnabhumi Airport since April 27. By Friday it had screened 404,134 passengers.

Monitoring of arrivals by air continues, with detection scanners out in force at Bangkok, Phuket and Chiangmai airports. Scanners have ordered and will soon be in place at land borders nationwide.

http://www.phuketgazette.net/news/index.asp?id=7331

It seems that a Thaivisa forum member also has concerns about the above news report.

geriatrickid wrote on May 12, 2009:

An unsettling report and one that is an embarrassing admission. It also speaks to the lack of preparedness of Thailand to deal with this virus.

<!--coloro:#0000ff--><!--/coloro-->...is awaiting confirmation of the infection from the Center for Disease Control (CDC) in the United States. The result of the CDC's tests are expected within seven days.<!--colorc--> <!--/colorc-->Sorry, but I believe that they wouldn't need to wait 7 days if they had invested in the facilities to do the cultures and mapping.

<!--coloro:#0000ff--><!--/coloro-->The ministry has already submitted that person's sample to the US CDC lab because Thailand has no sample of the A (H1N1) virus to compare with for confirmation, he said.<!--colorc--> <!--/colorc-->Unacceptable and misleading. Both the US CDC and the Canadian National Microbiology Lab have made samples and genetic codes readily available. Any health agency can get access. To say that they have no sample is the equivalent of saying that Thailand doesn't have a sufficent quantity of intellectual capital to work with the codes. Even if a sample was given, what exactly would Thailand do with the sample? Where are the specialized labs needed to deal with the virus? Basically, what the article says is that Thailand is scientifically inept. Heartbreaking statement because there are some very good researchers in Thailand and if I was one of them and read this, I'd be insulted.

Samples have been made available to the labs that have the expertise.
Need proof? That small specimen container that blew a safety gasket on a Swiss train a couple weaks ago was a shared sample. On May 8, the BBC reported that<!--coloro:#000000--> <!--/coloro-->Researchers at the US Centers for Disease Control and Prevention had already made genetic information on the swine flu virus publicly available to scientists around the world. <!--colorc--><!--/colorc-->The report then went on to discuss how the UK Health protection Agency was analyzing European samples using these codes. It's the genetic code of the virus that counts, not the virus itself when you need to identify the virus. How is it that tiny little New Zealand was able toundertake both genetic code and sample comparisons at Middlemore Hospital?

<!--coloro:#0000ff--><!--/coloro-->Chulalongkorn University virologist Yong Poovorawan applauded the ministry's submission of the sample to the CDC, as this was Thailand's first suspected case.<!--colorc--><!--/colorc-->
With all due respect to someone that has worked on avian flu and has a good reputation I wonder if he was quoted out of context. Is he applauding or lamenting the dispatch of samples. Just imagine what the professor could do if he had a state of the art lab, funding and a team of researchers.

<!--coloro:#0000ff--><!--/coloro-->The ministry has been screening arrivals, especially from Mexico, the US, Canada, Spain and the UK, at Bangkok's Suvarnabhumi Airport since April 27. By Friday it had screened 404,134 passengers.
<!--colorc--><!--/colorc-->So does this mean that countries that have cases get a free pass? What if they come in via another country like Taiwan or Malaysia? France, Italy and the UK and many other countries now have a significant number of cases. If you screen, you have to screen everyone, not just selected countries.

When I read articles like this, I feel for the Thai scientists and public health professionals. They deserve alot more respect than is shown.

http://www.thaivisa.com/forum/Swine-Flu-Case-Reported-Bangkok-t264266.html

 

[HenryN]

Re: Thailand - One H1N1 suspect

Re: Thailand - One H1N1 suspect

Actually, anyone who can google NCBI gets to the front page

http://www.ncbi.nlm.nih.gov/

Which has a center NOTICE for H1N1 sequences with this link

http://www.ncbi.nlm.nih.gov/genomes/FLU/SwineFlu.html
Which gives the page below with the Thai sequence among the most recent


<TABLE border=0 cellPadding=2><TBODY><TR><TD>The following 2009 H1N1 influenza virus sequences were submitted to NCBI and are available in GenBank:



</TD><TD width="5%"></TD><TD><">
<NOSCRIPT></NOSCRIPT>


</TD></TR></TBODY></TABLE>
May 09, 2009, 48 submitted by Unknown Pathogen Investigation Collaborative Team (UPICT) and Instituto de Diangnostico y Referencia Epidemiologicos (inDRE), Canada/Mexico; 1 by Hospital Clinic, Spain; 1 by Korea Centers for Disease Control and Prevention, South Korea; 1 by National Influenza Center, Thailand; 1 by National Institute for Infectious Diseases L. Spallanzani, Italy:
<TABLE border=0 cellPadding=2><THEAD><TR><TD></TD><TH>PB2</TH><TH>PB1</TH><TH>PA</TH><TH>HA</TH><TH>NP</TH><TH>NA</TH><TH>MP</TH><TH>NS</TH></TR></THEAD><TBODY><TR vAlign=top><TH align=left>Influenza A virus
(A/Canada-AB/RV1532/2009(H1N1))


</TH><TD>GQ132140</TD><TD>GQ132182</TD><TD>GQ132174</TD><TD>GQ132146</TD><TD>GQ132164</TD><TD>GQ132156</TD><TD>GQ132151</TD><TD>GQ132169</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Canada-NS/RV1536/2009(H1N1))


</TH><TD>GQ132141</TD><TD>GQ132183</TD><TD>GQ132175</TD><TD>GQ132147</TD><TD>GQ132165</TD><TD>GQ132158</TD><TD>GQ132152</TD><TD>GQ132170</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Canada-NS/RV1538/2009(H1N1))


</TH><TD>GQ132136</TD><TD>GQ132178</TD><TD>GQ132172</TD><TD>GQ132142</TD><TD>GQ132160</TD><TD>GQ132154</TD><TD>GQ132148</TD><TD>GQ132166</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Canada-ON/RV1526/2009(H1N1))


</TH><TD>GQ132137</TD><TD>GQ132180</TD><TD>GQ132177</TD><TD>GQ132143</TD><TD>GQ132162</TD><TD>GQ132159</TD><TD>GQ132153</TD><TD>GQ132171</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Canada-ON/RV1529/2009(H1N1))


</TH><TD>GQ132139</TD><TD>GQ132181</TD><TD>GQ132173</TD><TD>GQ132144</TD><TD>GQ132163</TD><TD>GQ132157</TD><TD>GQ132149</TD><TD>GQ132168</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Mexico/InDRE4114/2009(H1N1))


</TH><TD>GQ132138</TD><TD>GQ132179</TD><TD>GQ132176</TD><TD>GQ132145</TD><TD>GQ132161</TD><TD>GQ132155</TD><TD>GQ132150</TD><TD>GQ132167</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Catalonia/P48/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>GQ132186</TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Korea/01/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>GQ132185</TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Nonthaburi/102/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ132184</TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Italy/09/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD>GQ132187</TD><TD></TD><TD></TD><TD></TD></TR><TBODY></TBODY></TABLE>
May 08, 2009, 3 submitted by The Swedish Institute for Infectious Disease Control,Sweden; 4 by Hospital Clinic, Spain; 4 by Korea Centers for Disease Control and Prevention, South Korea; 16 by JCVI; 1 by INMI L.Spallanzani, Italy:
<TABLE border=0 cellPadding=2><THEAD><TR><TD></TD><TH>PB2</TH><TH>PB1</TH><TH>PA</TH><TH>HA</TH><TH>NP</TH><TH>NA</TH><TH>MP</TH><TH>NS</TH></TR></THEAD><TBODY><TR vAlign=top><TH align=left>Influenza A virus
(A/Catalonia/P148/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ122099</TD><TD></TD><TD>GQ122100</TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Catalonia/P154/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ122102</TD><TD></TD><TD>GQ122101</TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Stockholm/28/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ122105</TD><TD></TD><TD>GQ122104</TD><TD>GQ122103</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Korea/01/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ131023</TD><TD>GQ131024</TD><TD></TD><TD>GQ131025</TD><TD>GQ131026</TD></TR><TR vAlign=top><TH align=left>Influenza A Virus
(A/New York/1669/2009(H1N1))


</TH><TD>CY039900</TD><TD>CY039899</TD><TD>CY039898</TD><TD>CY039893</TD><TD>CY039896</TD><TD>CY039895</TD><TD>CY039894</TD><TD>CY039897</TD></TR><TR vAlign=top><TH align=left>Influenza A Virus
(A/New York/1682/2009(H1N1))


</TH><TD>CY039908</TD><TD>CY039907</TD><TD>CY039906</TD><TD>CY039901</TD><TD>CY039904</TD><TD>CY039903</TD><TD>CY039902</TD><TD>CY039905</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Italy/08/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD>GQ132135</TD><TD></TD><TD></TD><TD></TD></TR><TBODY></TBODY></TABLE>
May 07, 2009, 1 by Unknown Pathogen Investigation Collaborative Team (UPICT) and Instituto de Diangnostico y Referencia Epidemiologicos (inDRE), Canada/Mexico; 6 by CDC; 1 by WHO National Influenza Centre, New Zealand:
<TABLE border=0 cellPadding=2><THEAD><TR><TD></TD><TH>PB2</TH><TH>PB1</TH><TH>PA</TH><TH>HA</TH><TH>NP</TH><TH>NA</TH><TH>MP</TH><TH>NS</TH></TR></THEAD><TBODY><TR vAlign=top><TH align=left>Influenza A virus
(A/Canada-NS/RV1535/2009(H1N1))


</TH><TD>GQ120442</TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Christchurch/2/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>GQ122098</TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Texas/15/2009(H1N1))


</TH><TD></TD><TD>GQ122094</TD><TD></TD><TD>GQ122097</TD><TD>GQ122092</TD><TD>GQ122096</TD><TD>GQ122095</TD><TD>GQ122093</TD></TR><TBODY></TBODY></TABLE>
May 06, 2009, 102 submitted by CDC:
<TABLE border=0 cellPadding=2><THEAD><TR><TD></TD><TH>PB2</TH><TH>PB1</TH><TH>PA</TH><TH>HA</TH><TH>NP</TH><TH>NA</TH><TH>MP</TH><TH>NS</TH></TR></THEAD><TBODY><TR vAlign=top><TH align=left>Influenza A virus
(A/Arizona/01/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ117067</TD><TD>GQ117063</TD><TD>GQ117064</TD><TD>GQ117066</TD><TD>GQ117065</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Arizona/02/2009(H1N1))


</TH><TD>GQ117076</TD><TD>GQ117075</TD><TD></TD><TD>GQ117079</TD><TD>GQ117074</TD><TD>GQ117077</TD><TD>GQ117078</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/California/04/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ117044</TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/California/14/2009(H1N1))


</TH><TD>GQ117035</TD><TD>GQ117034</TD><TD>GQ117037</TD><TD>GQ117040</TD><TD>GQ117033</TD><TD>GQ117036</TD><TD>GQ117039</TD><TD>GQ117038</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Colorado/03/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ117119</TD><TD>GQ117117</TD><TD>GQ117118</TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Indiana/09/2009(H1N1))


</TH><TD></TD><TD>GQ117093</TD><TD>GQ117095</TD><TD>GQ117097</TD><TD>GQ117092</TD><TD>GQ117094</TD><TD>GQ117096</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Kansas/02/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ117059</TD><TD>GQ117057</TD><TD>GQ117058</TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Kansas/03/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ117062</TD><TD>GQ117060</TD><TD></TD><TD></TD><TD>GQ117061</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Massachusetts/06/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ117043</TD><TD>GQ117041</TD><TD>GQ117042</TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Massachusetts/07/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ117103</TD><TD>GQ117101</TD><TD>GQ117102</TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Michigan/02/2009(H1N1))


</TH><TD></TD><TD></TD><TD>GQ117109</TD><TD>GQ117112</TD><TD>GQ117107</TD><TD>GQ117108</TD><TD>GQ117111</TD><TD>GQ117110</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Minnesota/02/2009(H1N1))


</TH><TD>GQ117070</TD><TD>GQ117069</TD><TD></TD><TD></TD><TD>GQ117068</TD><TD>GQ117071</TD><TD>GQ117073</TD><TD>GQ117072</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Nebraska/02/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD>GQ117104</TD><TD>GQ117105</TD><TD></TD><TD>GQ117106</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/09/2009(H1N1))


</TH><TD></TD><TD>GQ117120</TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/13/2009(H1N1))


</TH><TD></TD><TD></TD><TD>GQ117115</TD><TD>GQ117116</TD><TD>GQ117113</TD><TD>GQ117114</TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/20/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ117082
GQ117086


</TD><TD>GQ117080
GQ117083


</TD><TD>GQ117081
GQ117084


</TD><TD>GQ117085</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/22/2009(H1N1))


</TH><TD>GQ117021</TD><TD>GQ117020</TD><TD></TD><TD>GQ117024</TD><TD>GQ117019</TD><TD>GQ117022</TD><TD>GQ117023</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Ohio/07/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ117100</TD><TD>GQ117098</TD><TD>GQ117099</TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/South Carolina/09/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>GQ117056</TD><TD>GQ117052</TD><TD>GQ117053</TD><TD>GQ117055</TD><TD>GQ117054</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Texas/07/2009(H1N1))


</TH><TD>GQ117089</TD><TD>GQ117088</TD><TD></TD><TD>GQ117091</TD><TD>GQ117087</TD><TD></TD><TD>GQ117090</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Texas/08/2009(H1N1))


</TH><TD>GQ117047</TD><TD>GQ117046</TD><TD>GQ117049</TD><TD>GQ117051</TD><TD>GQ117045</TD><TD>GQ117048</TD><TD>GQ117050</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Texas/09/2009(H1N1))


</TH><TD>GQ117027</TD><TD>GQ117026</TD><TD>GQ117029</TD><TD>GQ117032</TD><TD>GQ117025</TD><TD>GQ117028</TD><TD>GQ117031</TD><TD>GQ117030</TD></TR><TBODY></TBODY></TABLE>
May 05, 2009, 20 submitted by Instituto de Salud Carlos III, Spain; 3 by National Institute for Infectious Diseases 'Lazzaro Spallanzani', Italy; 4 by Israel Central Virology Laboratory, 23 by Unknown Pathogen Investigation Collaborative Team (UPICT) and Instituto de Diangnostico y Referencia Epidemiologicos (inDRE), Canada/Mexico:
<TABLE border=0 cellPadding=2><THEAD><TR><TD></TD><TH>PB2</TH><TH>PB1</TH><TH>PA</TH><TH>HA</TH><TH>NP</TH><TH>NA</TH><TH>MP</TH><TH>NS</TH></TR></THEAD><TBODY><TR vAlign=top><TH align=left>Influenza A virus
(A/Castilla-La Mancha/GP13/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ985753</TD><TD>FJ985751</TD><TD>FJ985754</TD><TD>FJ985750</TD><TD>FJ985752</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Castilla-La Mancha/GP9/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ985768</TD><TD>FJ985766</TD><TD>FJ985769</TD><TD>FJ985765</TD><TD>FJ985767</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Pais Vasco/GP20/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ985763</TD><TD>FJ985761</TD><TD>FJ985764</TD><TD>FJ985760</TD><TD>FJ985762</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Valencia/GP4/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ985758</TD><TD>FJ985756</TD><TD>FJ985759</TD><TD>FJ985755</TD><TD>FJ985757</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Italy/03/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ985804</TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Italy/04/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ985805</TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Italy/02/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ997636</TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Israel/G-640/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ986328</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Israel/G-645/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ986329</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Israel/MF-119/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ986331</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Israel/MF-70/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ986330</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Canada-NS/RV1535/2009(H1N1))


</TH><TD></TD><TD>FJ998225</TD><TD>FJ998222</TD><TD>FJ998207</TD><TD>FJ998216</TD><TD>FJ998213</TD><TD>FJ998210</TD><TD>FJ998219</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Canada-ON/RV1527/2009(H1N1))


</TH><TD>FJ998205</TD><TD>FJ998227</TD><TD>FJ998224</TD><TD>FJ998209</TD><TD>FJ998218</TD><TD>FJ998215</TD><TD>FJ998212</TD><TD>FJ998221</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Mexico/InDRE4487/2009(H1N1))


</TH><TD>FJ998206</TD><TD>FJ998226</TD><TD>FJ998223</TD><TD>FJ998208</TD><TD>FJ998217</TD><TD>FJ998214</TD><TD>FJ998211</TD><TD>FJ998220</TD></TR><TBODY></TBODY></TABLE>
May 04, 2009, 4 submitted by Statens Serum Institut, Denmark; 1 by Azienda Ospedaliero-Universitaria Pisana, Italy; 1 by Istituto Superiore di Sanita, Italy; 68 by CDC; 1 by University of Regensburg, Germany:
<TABLE border=0 cellPadding=2><THEAD><TR><TD></TD><TH>PB2</TH><TH>PB1</TH><TH>PA</TH><TH>HA</TH><TH>NP</TH><TH>NA</TH><TH>MP</TH><TH>NS</TH></TR></THEAD><TBODY><TR vAlign=top><TH align=left>Influenza A virus
(A/Denmark/513/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ982430</TD><TD></TD><TD>FJ982431</TD><TD>FJ982432</TD><TD>FJ982433</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Italy/01/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ982434</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Italy/02/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ984583</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/California/07/2009(H1N1))


</TH><TD>FJ984387</TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ984386</TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/California/08/2009(H1N1))


</TH><TD>FJ984365</TD><TD>FJ984367</TD><TD>FJ984368</TD><TD></TD><TD>FJ984366</TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/06/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ984341</TD><TD>FJ984340</TD><TD>FJ984338</TD><TD>FJ984339</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/10/2009(H1N1))


</TH><TD></TD><TD>FJ984373</TD><TD>FJ984374</TD><TD>FJ984375</TD><TD>FJ984372</TD><TD>FJ984371</TD><TD>FJ984369</TD><TD>FJ984370</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/11/2009(H1N1))


</TH><TD></TD><TD></TD><TD>FJ984346</TD><TD>FJ984347</TD><TD>FJ984345</TD><TD>FJ984344</TD><TD>FJ984342</TD><TD>FJ984343</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/12/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ984337</TD><TD>FJ984336</TD><TD>FJ984335</TD><TD></TD><TD>FJ984334</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/15/2009(H1N1))


</TH><TD></TD><TD></TD><TD>FJ984380</TD><TD></TD><TD>FJ984379</TD><TD>FJ984378</TD><TD>FJ984376</TD><TD>FJ984377</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/18/2009(H1N1))


</TH><TD>FJ984351</TD><TD>FJ984353</TD><TD>FJ984354</TD><TD>FJ984355</TD><TD>FJ984352</TD><TD>FJ984350</TD><TD>FJ984348</TD><TD>FJ984349</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/19/2009(H1N1))


</TH><TD></TD><TD>FJ984392</TD><TD>FJ984393</TD><TD>FJ984394</TD><TD>FJ984391</TD><TD>FJ984390</TD><TD>FJ984388</TD><TD>FJ984389</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/23/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ984364</TD><TD>FJ984363</TD><TD>FJ984362</TD><TD></TD><TD>FJ984361</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/31/2009(H1N1))


</TH><TD></TD><TD></TD><TD>FJ984359</TD><TD>FJ984360</TD><TD>FJ984358</TD><TD>FJ984357</TD><TD></TD><TD>FJ984356</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Ohio/07/2009(H1N1))


</TH><TD></TD><TD></TD><TD>FJ984400</TD><TD>FJ984397
FJ984401


</TD><TD>FJ984396</TD><TD></TD><TD>FJ984395
FJ984398


</TD><TD>FJ984399</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Texas/06/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ984385</TD><TD>FJ984384</TD><TD>FJ984383</TD><TD>FJ984381</TD><TD>FJ984382</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Regensburg/Germany/01/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ984953</TD><TD></TD><TD></TD></TR><TBODY></TBODY></TABLE>
May 1, 2009, 13 submitted by CDC; 1 by University of Geneva, Switzerland:
<TABLE border=0 cellPadding=2><THEAD><TR><TD></TD><TH>PB2</TH><TH>PB1</TH><TH>PA</TH><TH>HA</TH><TH>NP</TH><TH>NA</TH><TH>MP</TH><TH>NS</TH></TR></THEAD><TBODY><TR vAlign=top><TH align=left>Influenza A virus
(A/California/07/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ981613</TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Switzerland/01/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ981646</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Texas/04/2009(H1N1))


</TH><TD></TD><TD>FJ981616</TD><TD>FJ981619</TD><TD>FJ981612
FJ981615


</TD><TD>FJ981618</TD><TD>FJ981614</TD><TD>FJ981617</TD><TD>FJ981620</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Texas/05/2009(H1N1))


</TH><TD></TD><TD></TD><TD>FJ981610</TD><TD></TD><TD>FJ981609</TD><TD></TD><TD>FJ981608</TD><TD>FJ981611</TD></TR><TBODY></TBODY></TABLE>
April 30, 2009, 6 submitted by WHO CC for Reference and Research on Influenza, Australia; 1 by University of Regensburg, Germany; 7 by Ontario Agency for Health Protection and Promotion, Canada; 2 by Erasmus MC Rotterdam, Netherlands:
<TABLE border=0 cellPadding=2><THEAD><TR><TD></TD><TH>PB2</TH><TH>PB1</TH><TH>PA</TH><TH>HA</TH><TH>NP</TH><TH>NA</TH><TH>MP</TH><TH>NS</TH></TR></THEAD><TBODY><TR vAlign=top><TH align=left>Influenza A virus
(A/Auckland/3/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ973552</TD><TD>FJ973553</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Auckland/2/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ973554</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Auckland/1/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ973557</TD><TD></TD><TD>FJ973555</TD><TD>FJ973556</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Regensburg/Germany/01/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ974021</TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Toronto/3181/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ974022</TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Toronto/3170/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ974023</TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Toronto/3184/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ974024</TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Toronto/3178/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ974025</TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Toronto/3141/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ974026</TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Toronto/3145/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ974027</TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Toronto/3146/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ974028</TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Netherlands/602/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>CY039527</TD><TD></TD><TD>CY039528</TD><TD></TD><TD></TD></TR><TBODY></TBODY></TABLE>
April 29, 2009, 1 submitted by University of Regensburg, Germany; 3 by CDC:
<TABLE border=0 cellPadding=2><THEAD><TR><TD></TD><TH>PB2</TH><TH>PB1</TH><TH>PA</TH><TH>HA</TH><TH>NP</TH><TH>NA</TH><TH>MP</TH><TH>NS</TH></TR></THEAD><TBODY><TR vAlign=top><TH align=left>Influenza A virus
(A/Regensburg/Germany/01/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ970928</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/California/06/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ971075</TD><TD></TD><TD>FJ971074</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/California/08/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ971076</TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TBODY></TBODY></TABLE>
April 28, 2009, 34 submitted by CDC:
<TABLE border=0 cellPadding=2><THEAD><TR><TD></TD><TH>PB2</TH><TH>PB1</TH><TH>PA</TH><TH>HA</TH><TH>NP</TH><TH>NA</TH><TH>MP</TH><TH>NS</TH></TR></THEAD><TBODY><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/19/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ969509</TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/New York/20/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ969542</TD><TD></TD><TD>FJ969541</TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Kansas/03/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ969523</TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Ohio/07/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ969521
FJ969535


</TD><TD></TD><TD>FJ969520
FJ969534


</TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/California/04/2009(H1N1))


</TH><TD>FJ969516</TD><TD></TD><TD>FJ969515</TD><TD></TD><TD>FJ969512</TD><TD>FJ969517</TD><TD>FJ969513</TD><TD>FJ969514</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/California/07/2009(H1N1))


</TH><TD>FJ969530</TD><TD>FJ969531</TD><TD>FJ969529
FJ969539


</TD><TD>FJ969540</TD><TD>FJ969536</TD><TD></TD><TD>FJ969527
FJ969537


</TD><TD>FJ969528
FJ969538


</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/California/08/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD>FJ969518
FJ969532


</TD><TD>FJ969519
FJ969533


</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/California/10/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ969511</TD><TD></TD><TD></TD><TD>FJ969510</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Texas/04/2009(H1N1))


</TH><TD>FJ969525</TD><TD>FJ969526</TD><TD>FJ969524</TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Texas/05/2009(H1N1))


</TH><TD></TD><TD>FJ969522</TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD><TD></TD></TR><TBODY></TBODY></TABLE>
April 27, 2009, 40 submitted by CDC:
<TABLE border=0 cellPadding=2><THEAD><TR><TD></TD><TH>PB2</TH><TH>PB1</TH><TH>PA</TH><TH>HA</TH><TH>NP</TH><TH>NA</TH><TH>MP</TH><TH>NS</TH></TR></THEAD><TBODY><TR vAlign=top><TH align=left>Influenza A virus
(A/California/04/2009(H1N1))


</TH><TD>FJ966079</TD><TD>FJ966080</TD><TD>FJ966081</TD><TD>FJ966082</TD><TD>FJ966083</TD><TD>FJ966084</TD><TD>FJ966085</TD><TD>FJ966086</TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/California/05/2009(H1N1))


</TH><TD>FJ966955</TD><TD>FJ966958</TD><TD>FJ966957</TD><TD>FJ966952</TD><TD>FJ966953</TD><TD>FJ966956</TD><TD>FJ966954</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/California/06/2009(H1N1))


</TH><TD>FJ966963</TD><TD>FJ966965</TD><TD>FJ966964</TD><TD>FJ966960</TD><TD>FJ966961</TD><TD></TD><TD>FJ966962</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/California/07/2009(H1N1))


</TH><TD>FJ966976</TD><TD>FJ966978</TD><TD>FJ966977</TD><TD>FJ966974</TD><TD></TD><TD></TD><TD>FJ966975</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/California/09/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ966971</TD><TD></TD><TD>FJ966973</TD><TD>FJ966972</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Texas/04/2009(H1N1))


</TH><TD></TD><TD></TD><TD></TD><TD>FJ966982</TD><TD>FJ966979</TD><TD>FJ966981</TD><TD>FJ966980
FJ966983


</TD><TD></TD></TR><TR vAlign=top><TH align=left>Influenza A virus
(A/Texas/05/2009(H1N1))


</TH><TD></TD><TD></TD><TD>FJ966970</TD><TD>FJ966959</TD><TD>FJ966967</TD><TD>FJ966969</TD><TD>FJ966968</TD><TD>FJ966966</TD></TR><TBODY></TBODY></TABLE>
<MAP style="PADDING-BOTTOM: 0px; MARGIN: 0px; PADDING-LEFT: 0px; PADDING-RIGHT: 0px; PADDING-TOP: 0px" id=swineMapMini name=swineMapMini><AREA href="http://www.flu.gov/" shape=rect alt=Flu.gov target=_parent coords=2,0,148,90><AREA href="http://www.flu.gov/" shape=rect alt=Flu.gov target=_parent coords=2,90,148,121><AREA href="http://www.hhs.gov/web/library/hhsfluwidgets.html#flugovwidgetmini" shape=rect alt="Share This Widget" target=_parent coords=15,122,132,140></MAP>
<MAP style="PADDING-BOTTOM: 0px; MARGIN: 0px; PADDING-LEFT: 0px; PADDING-RIGHT: 0px; PADDING-TOP: 0px" id=swineMapMini name=swineMapMini><AREA href="http://www.flu.gov/" shape=rect alt=Flu.gov target=_parent coords=2,0,148,90><AREA href="http://www.flu.gov/" shape=rect alt=Flu.gov target=_parent coords=2,90,148,121><AREA href="http://www.hhs.gov/web/library/hhsfluwidgets.html#flugovwidgetmini" shape=rect alt="Share This Widget" target=_parent coords=15,122,132,140></MAP>

 

[HenryN]

Re: Thailand - One H1N1 suspect

Re: Thailand - One H1N1 suspect

Chulalongkorn University virologist Yong Poovorawan applauded the ministry's submission of the sample to the CDC, as this was Thailand's first suspected case.<!--colorc--><!--/colorc-->
With all due respect to someone that has worked on avian flu and has a good reputation I wonder if he was quoted out of context. Is he applauding or lamenting the dispatch of samples. Just imagine what the professor could do if he had a state of the art lab, funding and a team of researchers.

Actually, Yong has a world class sequencing lab (although he just does animal sequences) and was one of the first to get H5N1 sequences published at Genbank (in Febraury, 2004), including sequences from the dead tigers.

However, the partial sequence at GenBank leaves NO doubt that the Thai sequences were from HA from the same swine H1N1 that is circling the globe, as transmission is SUSTAINED.

 

[Gert van der Hoek]

Re: Thailand - One H1N1 suspect

Re: Thailand - One H1N1 suspect

Tuesday May 12, 2009

Thailand confirms first H1N1 flu case

BANGKOK (Reuters) - Thailand confirmed its first case of the H1N1 flu on Tuesday, but the patient has recovered and there were no reports of more infections, Prime Minister Abhisit Vejjajiva said.

The Public Health Ministry has scheduled a news conference for 2 p.m. (0700 GMT) to discuss the test results confirmed by the U.S.-based Centers for Disease Control (CDC).


A child wearing a surgical mask talks on a phone in San Jose, May 11, 2009. (REUTERS/Juan Carlos Ulate)
"The returned lab result confirmed that it was the infection, but the person has recovered from it," Abhisit told reporters.

The World Health Organization (WHO) has confirmed 4,379 infections worldwide, with the worst impact in North America, where 60 people have died.

Despite the small number of cases to date in Asia, health experts say the region cannot afford to be complacent after bouts of SARS and bird flu in recent years.

Last week, health ministers from 13 Asian countries agreed in Bangkok to boost antiviral drug stockpiles and tighten surveillance against the virus, also known as swine flu.

The global spread of the virus has raised concerns about a possible pandemic, although scientists say this strain does not appear more deadly than seasonal flu.

Nevertheless, the impact of H1N1 on global travel has added to the gloom in Thailand's tourist industry, which has already suffered a sharp drop in arrivals due to the global economic crisis and political unrest at home.

http://thestar.com.my/news/story.as...01_NOOTR_RTRMDNC_0_-395631-4&sec=Worldupdates

 

[nomadic wench]

Re: Thailand - One H1N1 suspect

Re: Thailand - One H1N1 suspect

I'm surprised they can't do the sequencing themselves too. Chulalongkorn and Mahidol universities do some good research and some of the hospitals in Bangkok are more state of the art than anything I've seen in Europe. Lots of very expensive equipment.

I thought I saw the WHO or CDC asking governments to send them samples for confirmation somewhere. Maybe they don't update their stats until they see for themselves?

 

[Gert van der Hoek]

Re: Thailand - One H1N1 suspect

Re: Thailand - One H1N1 suspect

I'm surprised they can't do the sequencing themselves too. Chulalongkorn and Mahidol universities do some good research and some of the hospitals in Bangkok are more state of the art than anything I've seen in Europe. Lots of very expensive equipment.

I thought I saw the WHO or CDC asking governments to send them samples for confirmation somewhere. Maybe they don't update their stats until they see for themselves?

Being no expert at all, I have been told you need a primer for a PCR-test.

Could it be is simple as this:

No one took the initiative to design a primer for A/H1N1 in Thailand?

WHO did not distribute the primer to countries which could need it?

I suppose (many) other countries could have the same problem ?

 

[HenryN]

Re: Thailand - One H1N1 suspect

Re: Thailand - One H1N1 suspect

Being no expert at all, I have been told you need a primer for a PCR-test.

Could it be is simple as this:

No one took the initiative to design a primer for A/H1N1 in Thailand?

WHO did not distribute the primer to countries which could need it?

I suppose (many) other countries could have the same problem ?

No, that's not the problem. Like H5N1, H1N1 is ALL about politics.

The sequence at Genbank, deposited on May 9, was depsited by THAI researchers (no CDC required).

AUTHORS de Silva,J.W., Lukebua,A., Waicharoen,S. and Chitakanpitch,M.
TITLE Direct Submission
JOURNAL Submitted (09-MAY-2009) National Influenza Center, Department of
Medical Sciences, 88/7 Ministry of Public Health Tiwanon Rd.,
Muang, Nonthaburi 11000, Thailand
COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009.

 

[HenryN]

Re: Thailand - A / H1N1 confirmed

Re: Thailand - A / H1N1 confirmed

I think the politics of this confirmation is of interest.

On May 9, researchers in Thailand submitted a partial Ha sequence from a patient in,Nonthaburi, Thailand (A/Nonthaburi/102/2009). Although the sequence was only a patial sequence, it was virtiually identical to swine H1N1 desposited at Genbank and GISAID by researchers around the world. A BLAST of the sequence at Genbank (which takes less than 5 seconds) leaves no doubt that the isollate is swine H1N1.

The official announcement states that there is lab data supporting a swine flu diagnosis, but confimration at the CDC is required and will take a week.

However, Genbank is releasing sequences in real time, so on May 9 it was clear to anyone who looked at the front page of the site, that H1N1 had been confirmed in Thailand, providing additional evidence os SUSTAINED transmission of H1N1 outside of North America.

 

[HenryN]

Re: Thailand - A / H1N1 confirmed

Re: Thailand - A / H1N1 confirmed

<TABLE border=1><CAPTION>INFLUENZA VIRUSES ISOLATED BY
WHO/NREVSS Collaborating Laboratories
2008 - 2009 Season </CAPTION><TBODY><TR><TH id=header1 width=70>Week</TH><TH id=header2 width=90>A(H1)</TH><TH id=header5 width=70>A(Novel H1N1)</TH><TH id=header3 width=70>A(H3)</TH><TH id=header4 width=70>A(Could Not Subtyped)</TH><TH id=header4 width=70>A(Unk)</TH><TH id=header5 width=70>B </TH><TH id=header6 align=right>Total # Tested</TH><TH id=header7 align=right>% Positive</TH></TR><TR><TD headers=header1 align=right>40 </TD><TD headers=header2 align=right>3 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>0 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>8 </TD><TD headers=header5 align=right>6 </TD><TD headers=header6 align=right>2574 </TD><TD headers=header7 align=right>0.66 </TD></TR><TR><TD headers=header1 align=right>41 </TD><TD headers=header2 align=right>4 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>4 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>8 </TD><TD headers=header5 align=right>6 </TD><TD headers=header6 align=right>2593 </TD><TD headers=header7 align=right>0.85 </TD></TR><TR><TD headers=header1 align=right>42 </TD><TD headers=header2 align=right>13 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>3 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>15 </TD><TD headers=header5 align=right>6 </TD><TD headers=header6 align=right>2698 </TD><TD headers=header7 align=right>1.37 </TD></TR><TR><TD headers=header1 align=right>43 </TD><TD headers=header2 align=right>22 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>0 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>24 </TD><TD headers=header5 align=right>14 </TD><TD headers=header6 align=right>3155 </TD><TD headers=header7 align=right>1.9 </TD></TR><TR><TD headers=header1 align=right>44 </TD><TD headers=header2 align=right>12 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>3 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>21 </TD><TD headers=header5 align=right>5 </TD><TD headers=header6 align=right>3262 </TD><TD headers=header7 align=right>1.26 </TD></TR><TR><TD headers=header1 align=right>45 </TD><TD headers=header2 align=right>32 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>2 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>23 </TD><TD headers=header5 align=right>11 </TD><TD headers=header6 align=right>3858 </TD><TD headers=header7 align=right>1.76 </TD></TR><TR><TD headers=header1 align=right>46 </TD><TD headers=header2 align=right>25 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>2 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>23 </TD><TD headers=header5 align=right>12 </TD><TD headers=header6 align=right>4089 </TD><TD headers=header7 align=right>1.52 </TD></TR><TR><TD headers=header1 align=right>47 </TD><TD headers=header2 align=right>27 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>1 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>31 </TD><TD headers=header5 align=right>23 </TD><TD headers=header6 align=right>4461 </TD><TD headers=header7 align=right>1.84 </TD></TR><TR><TD headers=header1 align=right>48 </TD><TD headers=header2 align=right>40 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>1 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>47 </TD><TD headers=header5 align=right>24 </TD><TD headers=header6 align=right>4570 </TD><TD headers=header7 align=right>2.45 </TD></TR><TR><TD headers=header1 align=right>49 </TD><TD headers=header2 align=right>43 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>6 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>57 </TD><TD headers=header5 align=right>14 </TD><TD headers=header6 align=right>5253 </TD><TD headers=header7 align=right>2.28 </TD></TR><TR><TD headers=header1 align=right>50 </TD><TD headers=header2 align=right>71 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>9 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>66 </TD><TD headers=header5 align=right>37 </TD><TD headers=header6 align=right>5664 </TD><TD headers=header7 align=right>3.23 </TD></TR><TR><TD headers=header1 align=right>51 </TD><TD headers=header2 align=right>73 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>19 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>108 </TD><TD headers=header5 align=right>56 </TD><TD headers=header6 align=right>5956 </TD><TD headers=header7 align=right>4.3 </TD></TR><TR><TD headers=header1 align=right>52 </TD><TD headers=header2 align=right>71 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>12 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>153 </TD><TD headers=header5 align=right>51 </TD><TD headers=header6 align=right>5731 </TD><TD headers=header7 align=right>5.01 </TD></TR><TR><TD headers=header1 align=right>53 </TD><TD headers=header2 align=right>115 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>19 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>171 </TD><TD headers=header5 align=right>48 </TD><TD headers=header6 align=right>6211 </TD><TD headers=header7 align=right>5.68 </TD></TR><TR><TD headers=header1 align=right>01 </TD><TD headers=header2 align=right>165 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>27 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>285 </TD><TD headers=header5 align=right>82 </TD><TD headers=header6 align=right>6598 </TD><TD headers=header7 align=right>8.47 </TD></TR><TR><TD headers=header1 align=right>02 </TD><TD headers=header2 align=right>196 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>22 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>423 </TD><TD headers=header5 align=right>96 </TD><TD headers=header6 align=right>6640 </TD><TD headers=header7 align=right>11.1 </TD></TR><TR><TD headers=header1 align=right>03 </TD><TD headers=header2 align=right>340 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>44 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>623 </TD><TD headers=header5 align=right>186 </TD><TD headers=header6 align=right>7486 </TD><TD headers=header7 align=right>15.94 </TD></TR><TR><TD headers=header1 align=right>04 </TD><TD headers=header2 align=right>558 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>77 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>898 </TD><TD headers=header5 align=right>359 </TD><TD headers=header6 align=right>8896 </TD><TD headers=header7 align=right>21.27 </TD></TR><TR><TD headers=header1 align=right>05 </TD><TD headers=header2 align=right>674 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>52 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>1359 </TD><TD headers=header5 align=right>672 </TD><TD headers=header6 align=right>11346 </TD><TD headers=header7 align=right>24.3 </TD></TR><TR><TD headers=header1 align=right>06 </TD><TD headers=header2 align=right>814 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>63 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>1337 </TD><TD headers=header5 align=right>911 </TD><TD headers=header6 align=right>12372 </TD><TD headers=header7 align=right>25.26 </TD></TR><TR><TD headers=header1 align=right>07 </TD><TD headers=header2 align=right>817 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>65 </TD><TD headers=header5 align=right>1 </TD><TD headers=header4 align=right>1068 </TD><TD headers=header5 align=right>894 </TD><TD headers=header6 align=right>11378 </TD><TD headers=header7 align=right>25 </TD></TR><TR><TD headers=header1 align=right>08 </TD><TD headers=header2 align=right>669 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>59 </TD><TD headers=header5 align=right>1 </TD><TD headers=header4 align=right>1002 </TD><TD headers=header5 align=right>1097 </TD><TD headers=header6 align=right>11598 </TD><TD headers=header7 align=right>24.38 </TD></TR><TR><TD headers=header1 align=right>09 </TD><TD headers=header2 align=right>527 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>57 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>882 </TD><TD headers=header5 align=right>1086 </TD><TD headers=header6 align=right>10342 </TD><TD headers=header7 align=right>24.68 </TD></TR><TR><TD headers=header1 align=right>10 </TD><TD headers=header2 align=right>353 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>63 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>638 </TD><TD headers=header5 align=right>1002 </TD><TD headers=header6 align=right>9106 </TD><TD headers=header7 align=right>22.58 </TD></TR><TR><TD headers=header1 align=right>11 </TD><TD headers=header2 align=right>346 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>62 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>429 </TD><TD headers=header5 align=right>873 </TD><TD headers=header6 align=right>8160 </TD><TD headers=header7 align=right>20.96 </TD></TR><TR><TD headers=header1 align=right>12 </TD><TD headers=header2 align=right>257 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>41 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>281 </TD><TD headers=header5 align=right>597 </TD><TD headers=header6 align=right>6707 </TD><TD headers=header7 align=right>17.53 </TD></TR><TR><TD headers=header1 align=right>13 </TD><TD headers=header2 align=right>107 </TD><TD headers=header4 align=right>1 </TD><TD headers=header3 align=right>25 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>163 </TD><TD headers=header5 align=right>430 </TD><TD headers=header6 align=right>5115 </TD><TD headers=header7 align=right>14.19 </TD></TR><TR><TD headers=header1 align=right>14 </TD><TD headers=header2 align=right>87 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>31 </TD><TD headers=header5 align=right>1 </TD><TD headers=header4 align=right>122 </TD><TD headers=header5 align=right>246 </TD><TD headers=header6 align=right>4357 </TD><TD headers=header7 align=right>11.18 </TD></TR><TR><TD headers=header1 align=right>15 </TD><TD headers=header2 align=right>37 </TD><TD headers=header4 align=right>0 </TD><TD headers=header3 align=right>28 </TD><TD headers=header5 align=right>0 </TD><TD headers=header4 align=right>70 </TD><TD headers=header5 align=right>158 </TD><TD headers=header6 align=right>3810 </TD><TD headers=header7 align=right>7.69 </TD></TR><TR><TD headers=header1 align=right>16 </TD><TD headers=header2 align=right>39 </TD><TD headers=header4 align=right>8 </TD><TD headers=header3 align=right>31 </TD><TD headers=header5 align=right>5 </TD><TD headers=header4 align=right>76 </TD><TD headers=header5 align=right>86 </TD><TD headers=header6 align=right>3164 </TD><TD headers=header7 align=right>7.74 </TD></TR><TR><TD headers=header1 align=right>17 </TD><TD headers=header2 align=right>370 </TD><TD headers=header4 align=right>524 </TD><TD headers=header3 align=right>343 </TD><TD headers=header5 align=right>259 </TD><TD headers=header4 align=right>269 </TD><TD headers=header5 align=right>338 </TD><TD headers=header6 align=right>14928 </TD><TD headers=header7 align=right>14.09 </TD></TR></TBODY></TABLE>

 

[Gert van der Hoek]

Re: Thailand - A / H1N1 confirmed

Re: Thailand - A / H1N1 confirmed

It seems to be TWO patients.

Tuesday, May 12, 2009

Thailand reports first confirmed case of swine flu

The Associated Press , Bangkok | Tue, 05/12/2009 4:02 PM | World

Thailand's health minister announced Tuesday that the Southeast Asian country had confirmed its first cases of swine flu in two people who had recently returned from Mexico, and both wre recovering.

Health Minister Witthaya Keawparadai declined to disclose details about the patients, citing doctor-patient confidentiality and the fact that both were recovering.

"We have confirmed two cases of H1N1 influenza A," Witthaya told a news conference. "There is no outbreak in Thailand." The cases in Thailand also marked the official arrival of swine flu in Southeast Asia. Other countries on the continent have reported cases, including China, Japan and South Korea.

Shortly before the news conference, Prime Minister Abhisit Vejjajiva had told reporters that authorities had confirmed Thailand's first case of swine flu in a single male patient.

He said health authorities had sent a sample from the patient last week to the U.S. Centers for Disease Control for final testing.

"The U.S. has confirmed the case," Abhisit told reporters, adding, "I understand he is safe ... He has recovered, as far as I know."

http://www.thejakartapost.com/news/2009/05/12/thailand-reports-first-confirmed-case-swine-flu.html

 

[HenryN]

Re: Thailand - A / H1N1 cases confirmed

Re: Thailand - A / H1N1 cases confirmed

<a rel="nofollow" href="http://www.recombinomics.com/News/05120901/Swine_H1N1_Thailand.html">Commentary</a>

 

[FluBossie]

Re: Thailand - A / H1N1 cases confirmed

Re: Thailand - A / H1N1 cases confirmed

Thailand says two flu patients visited Mexico

Tue May 12, 2009 9:14am BST

BANGKOK (Reuters) - Two Thais who returned from Mexico have been confirmed with H1N1 flu but have recovered from the virus, Health Minister Witthaya Kaewparadai said on Tuesday.
Eight other Thais who were in contact with the two infected people were released after being quarantined for a week and show no signs of the virus, he said.
"We have found two confirmed cases of the flu, which was contracted abroad. They have recovered," Witthaya told a news conference.
He gave no details of the two patients and did not say when or where they had travelled in Mexico, the epicentre of the outbreak also known as swine flu.
The World Health Organisation has confirmed 4,379 infections worldwide, with the worst impact in North America, where 60 people have died, mostly in Mexico.
Despite the small number of cases to date in Asia, health experts say the region cannot afford to be complacent after bouts of SARS and bird flu in recent years.
Last week, health ministers from 13 Asian countries agreed in Bangkok to boost antiviral drug stockpiles and tighten surveillance against the virus.
The global spread of the virus has raised concerns about a possible pandemic, although scientists say this strain does not appear more deadly than seasonal flu.
Nevertheless, the impact of H1N1 on global travel has added to the gloom in Thailand's tourist industry, which has already suffered a sharp drop in arrivals due to the global economic crisis and political unrest at home.
(Reporting by Kittipong Soonprasert; Writing by Darren Schuettler; Editing by Alan Raybould and Dean Yates)


© Thomson Reuters 2009 All rights reserved.

http://uk.reuters.com/article/worldNews/idUKTRE54B0ZO20090512

 

[nomadic wench]

Re: Thailand - A / H1N1 cases confirmed

Re: Thailand - A / H1N1 cases confirmed

Well Thailand has had a lot of concerns about its tourism industry lately...anti-government riots and airport closures as well as SARS, birdflu and economic crisis etc so they could be tempted to keep it quiet. However as countries like the US are far more affected right now it wouldn't make much sense to be secretive.

Just saw Muscade has posted about a second confirmed case in the French section.

Les échantillons de virus prélevés sur le patient ont été envoyés au Centre américain pour le contrôle des maladies (USCDC, en sigle anglais) et ce dernier a confirmé au gouvernement thaïlandais que le patient était infecté à la grippe A/H1N1, a fait savoir M. Witthaya.
En ce qui concerne le deuxième cas, le ministre a précisé que le patient s'était senti souffrant avec une fièvre modérée trois jours après son arrivée en Thaïlande, alors que les tests de laboratoire ont également confirmé que le second cas avait été infecté par la grippe A/H1N1.

My amateur translation.

Samples taken from the patient were sent to the CDC and the latter confirmed to the Thai government. that the patient was infected by influenza A/H1N1, said Mr Witthaya.

As for the second case, the minister specified that the patient felt ill with a moderate fever three days after his arrival in Thailand, and tests have also confirmed the second case had been infected with influenza A/H1N1

Maybe the Thai govt just needed confirmation too before announcing the first case? No mention of CDC for the second case.

 

[HenryN]

Re: Thailand - A / H1N1 cases confirmed

Re: Thailand - A / H1N1 cases confirmed

Well Thailand has had a lot of concerns about its tourism industry lately...anti-government riots and airport closures as well as SARS, birdflu and economic crisis etc so they could be tempted to keep it quiet. However as countries like the US are far more affected right now it wouldn't make much sense to be secretive.

Just saw Muscade has posted about a second confirmed case in the French section.




My amateur translation.



Maybe the Thai govt just needed confirmation too before announcing the first case? No mention of CDC for the second case.

H1N1, like H5N1 is ALL about politics (no science required).
There was NO doubt on May 9 that swine H1N1 was in patients in Thailand.