• FluTrackers.com Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster. The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website. By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.
  • We are not asking for any donations. Do not donate to any entity who says they are raising funds for us.

Seasonal Flu - H274Y also in Washington - Tamiflu resistant but Adamantane sensitive ??

Toaster2

Resident
I just stumbled into this:

|243031411|gb|GQ338344.1|
http://www.ncbi.nlm.nih.gov/genomes/FLU/SwineFlu.html

I do not see YYY, but:
PNFYYEEC

Specifically marked as H274Y in the link. But is this also Tamiflu resistant without the first Y


CommentFeaturesSequenceLOCUS GQ338344 1413 bp cRNA linear VRL 01-JUL-2009
DEFINITION Influenza A virus (A/Washington/01/2009(H1N1)) segment 6
neuraminidase (NA) gene, complete cds.
ACCESSION GQ338344
VERSION GQ338344.1 GI:243031411
DBLINK Project:37813
KEYWORDS .
SOURCE Influenza A virus (A/Washington/01/2009(H1N1))
ORGANISM Influenza A virus (A/Washington/01/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1413)
AUTHORS Garten,R.
TITLE Direct Submission
JOURNAL Submitted (01-JUL-2009) Centers for Disease Control and Prevention,
NCIRD/Influenza Division/VSDB, Centers for Disease Control and
Prevention, Atlanta, 1600 Clifton Road, N.E., Atlanta, GA 30333,
USA
COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009. For more information, see http://www.cdc.gov/.

Some of the information does not have GenBank feature identifiers
and is being provided in the comment section.

##EpifluData-START##
Isolate A/Washington/01/2009
Subtype H1N1
Segment_name NA
Passage_history M1/C1
Adamantane_resistance sensitive
Zanamivir_resistance sensitive
Oseltamivir_resistance resistant
Country USA
State/Province Washington state
Collection_day 1
Collection_month 1
Collection_year 2009
EPI_accession EPI172828
Lineage swl
##EpifluData-END##
FEATURES Location/Qualifiers
source 1..1413
/organism="Influenza A virus (A/Washington/01/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/Washington/01/2009"
/serotype="H1N1"
/host="Homo sapiens"
/db_xref="taxon:656510"
/segment="6"
/country="USA: Washington state"
/collection_date="01-Jan-2009"
gene 1..1413
/gene="NA"
CDS 1..1413
/gene="NA"
/codon_start=1
/product="neuraminidase"
/protein_id="ACS94505.1"
/db_xref="GI:243031412"
/translation="MNPNQKIITIGSISIAIGIISLMLQIGNIISIWASHSIQTGSQN
NTGICNQRIITYENSTWVNHTYVNINNTNVVAGEDKTSVTLAGNSSLCSISGWAIYTK
DNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNXTVKDRSPYRALMS
CPLGEAPSPYNSKFESVAWSASACHDGMGWLTIGISGPDNGAVAVLKYNGIITGTIKS
WKKQILRTQESECVCMNGSCFTIMTDGPSNKAASYKIFKIEKGKVTKSIELNAPNFYY
EECSCYPDTGIVMCVCRDNWHGSNRPWVSFNQNLDYQIGYICSGVFGDNPRPEDGEGS
CNPVTVDGANGVKGFSYKYGNGVWIGRTKSNRLRKGFEMIWDPNGWTNTDSDFSVKQD
VVAITDWSGYSGSFVQHPELTGLDCIRPCFWVELVRGLPRENTTIWTSGSSISFCGVN
SDTANWSWPDGAELPFTIDK"
ORIGIN
1 atgaacccaa atcaaaagat aataaccatt ggatcaatca gtatagcaat cggaataatt
61 agtctaatgt tgcaaatagg aaatattatt tcaatatggg ctagtcactc aatccaaact
121 ggaagtcaaa acaacactgg aatatgcaac caaagaatca tcacatatga aaacagcacc
181 tgggtgaatc acacatatgt taatattaac aacactaatg ttgttgctgg agaggacaaa
241 acgtcagtga cattggccgg caattcatct ctttgttcta tcagtggatg ggctatatac
301 acaaaagaca acagcataag aattggctcc aaaggagatg tttttgtcat aagagaacct
361 ttcatatcat gttctcactt ggaatgcaga accttttttc tgacccaagg cgctctgtta
421 aatgacaaac attcaaatrg gaccgtaaag gacagaagtc cttatagggc cttaatgagc
481 tgtcctctag gtgaagctcc gtccccatac aattcaaaat tcgaatcagt tgcatggtca
541 gcaagcgcat gccatgatgg catgggctgg ttaacaatcg gaatttctgg tccagacaat
601 ggagctgtgg ctgtactaaa atacaacgga ataataactg gaaccataaa aagttggaaa
661 aagcaaatat taagaacaca agagtctgaa tgtgtctgta tgaacgggtc atgtttcacc
721 ataatgaccg atggcccgag taataaagcc gcctcgtaca aaattttcaa gatcgaaaag
781 gggaaggtta ctaaatcaat agagttgaat gcacccaatt tttattatga ggaatgctcc
841 tgttacccag acactggcat agtgatgtgt gtatgcaggg acaactggca tggttcaaat
901 cgaccttggg tgtcttttaa tcaaaatttg gattatcaaa taggatacat ctgcagtgga
961 gtgtttggtg acaatccgcg tcccgaagat ggagagggca gctgcaatcc agtgactgtt
1021 gatggagcaa acggggtgaa agggttttca tacaaatatg gtaatggtgt ttggatagga
1081 aggaccaaaa gtaacagact tagaaagggg tttgagatga tttgggatcc taatggatgg
1141 acaaataccg acagtgattt ctcagtgaaa caggatgttg tagcaataac tgattggtca
1201 gggtacagcg gaagtttcgt ccaacatcct gagttgacag gattggactg tataagacct
1261 tgcttctggg ttgagttagt cagagggctg cctagagaaa atacaacaat ctggactagt
1321 gggagcagca tttctttttg tggcgttaat agtgatactg caaactggtc ttggccagac
1381 ggtgctgagt tgccgttcac cattgacaag tag
//
 
Last edited:
Re: H274Y also in Washington - available since july 1st

Re: H274Y also in Washington - available since july 1st

Adamantane_resistance sensitiv

Isn't swine flu adamantane resistant?
 
Re: H274Y also in Washington - available since july 1st

Re: H274Y also in Washington - available since july 1st

Maybe that is because of the Y273F ?
 
Re: H274Y also in Washington - Tamiflu resistant but Adamantane sensitive ??

Re: H274Y also in Washington - Tamiflu resistant but Adamantane sensitive ??

Seasonal flu.
 
Re: H274Y also in Washington - available since july 1st

Re: H274Y also in Washington - available since july 1st

Isn't swine flu adamantane resistant?
Yes, the sequence on this thread is seasonal H1N1 (99% have H274Y and are adamantane sensitive).
 
Re: H274Y also in Washington - Tamiflu resistant but Adamantane sensitive ??

Re: H274Y also in Washington - Tamiflu resistant but Adamantane sensitive ??

Thanks Toaster2.
 
Re: H274Y also in Washington - Tamiflu resistant but Adamantane sensitive ??

Re: H274Y also in Washington - Tamiflu resistant but Adamantane sensitive ??

Thanks Toaster2.
There are 100's of recent seasonal flu H1N1 sequences at Genbank and almost ALL have H274Y.
 
Re: H274Y also in Washington - available since july 1st

Re: H274Y also in Washington - available since july 1st

That implies someone is being sloppy because:

COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009. For more information, see http://www.cdc.gov/.
 
Re: H274Y also in Washington - available since july 1st

Re: H274Y also in Washington - available since july 1st

Yes, the sequence on this thread is seasonal H1N1 (99% have H274Y and are adamantane sensitive).

Any idea why the sequence is in a H1N1 outbreak database ? I know seasonal is also H1N1, but would have thought to find only newH1N1 in this database. Or has it picked up FYY from seasonal ?
 
Re: H274Y also in Washington - available since july 1st

Re: H274Y also in Washington - available since july 1st

Any idea why the sequence is in a H1N1 outbreak database ? I know seasonal is also H1N1, but would have thought to find only newH1N1 in this database. Or has it picked up FYY from seasonal ?

Whoever posted it marked it as swine.
 
Re: H274Y also in Washington - available since july 1st

Re: H274Y also in Washington - available since july 1st

Any idea why the sequence is in a H1N1 outbreak database ? I know seasonal is also H1N1, but would have thought to find only newH1N1 in this database. Or has it picked up FYY from seasonal ?
No. It's seasonal (but collected in 2009).
 
Re: Seasonal Flu - H274Y also in Washington - Tamiflu resistant but Adamantane sensitive ??

The first pandemic H1N1 sequences were from isolates collected in March 2009 or later.

Then sloppy it is...... I'll change the title again.
 
Re: Seasonal Flu - H274Y also in Washington - Tamiflu resistant but Adamantane sensitive ??

attachment.php

(doesn't include recent reports of tamiflu resistance in Denmark and Japan)


http://www.cdc.gov/flu/weekly/
 

Attachments

  • resistance.jpg
    resistance.jpg
    201.6 KB · Views: 1
Re: Seasonal Flu - H274Y also in Washington - Tamiflu resistant but Adamantane sensitive ??

If you choose a few H1N1s from December 2008, then that Washington sample, then a few obviously new H1N1s and do an alignment - the Washington clearly matches 2008 H1N1.

Here are some HAs:

Code:
Positions from 1 till 60
 Consensus sequence   M K V K L L V L L C T F T A T Y A D T I C I G Y H A N N S T D T V D T V L E K N V T V T H S V N L L E N S H N G K L C L 
ACM51274  A/Maryland/05/2008(H1N1) . . . . . . I . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
ACM51261  A/Virginia/03/2008(H1N1) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
ACM51298  A/North Dakota/01/2008(H1N1) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
ACS94541  A/[B]Washington[/B]/01/2009(H1N1) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
ACP41926  A/California/05/2009(H1N1) . . A I . V . M . Y . . A T A N . . . L . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D K . . . . . . K 
ACR08529  A/New Jersey/01/2009(H1N1) . . A I . V . . . Y . . A T A N . . . L . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D K . . . . . . K 
ACR08541  A/New York/04/2009(H1N1) . . A I . V . . . Y . . A T A N . . . L . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D K . .

Here are some NAs:

Code:
Positions from 1 till 60
 Consensus sequence   M N P N Q K I I T I G S I S I A I G I I S L M L Q I G N I I S I W A S H S I Q T G S Q N N T G I C N Q R I I T Y E N S T 
ACM51293  A/Illinois/16/2008(H1N1) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
ACM51319  A/Michigan/06/2008(H1N1) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
ACM51256  A/Nebraska/07/2008(H1N1) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
ACM51306  A/Minnesota/27/2008(H1N1) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
ACS94505  A/[B]Washington[/B]/01/2009(H1N1) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
ACP41107  A/California/04/2009(H1N1) . . . . . . . . . . . . V C M T . . M A N . I . . . . . . . . . . I . . . . . L . N . . Q I E T . . . S V . . . . . N . 
ACP41947  A/Texas/05/2009(H1N1) . . . . . . . . . . . . V C M T . . M A N . I . . . . . . . . . . I . . . . . L . N . . Q I E T . . . S V . . . . . N . 
ACQ76379  A/Indiana/09/2009(H1N1) . . . . . . . . . . . . V C M T . . M A N . I . . . . . . . . . . I . . . . . L . N . . Q I E T . . . S V . . . K . N . 
ACP44181  A/Ohio/07/2009(H1N1) . . . . . . . . . . . . V C M T . . M A N . I . . . . . . . . . . I . . . . . L . N . . Q I E T . . . S V . . . . . N .

.
 
Last edited:
Back
Top