• FluTrackers.com Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster. The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website. By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.
  • We are not asking for any donations. Do not donate to any entity who says they are raising funds for us.

New bird flu virus killing US baby seals (H3N8)

Laidback Al

New member
New bird flu virus killing US baby seals

WASHINGTON (AFP) ? A new kind of bird flu has been causing deadly pneumonia in baby seals off the northeastern US coast and could pose a risk to humans, according to US research released Tuesday.
The new strain has been named avian H3N8, and is blamed for the deaths of 162 seals along the US coastlines last year, said the study in mBio, a journal of the American Society for Microbiology.
Most of the dead seals were younger than six months of age.

While there have been no known human cases to date, scientists at Columbia University in New York urged caution, given the history of bird flu and its ability to evolve into forms that can infect people, like H5N1.

?Our findings reinforce the importance of wildlife surveillance in predicting and preventing pandemics,? said W. Ian Lipkin, professor of epidemiology at the Columbia University Mailman School of Public Health. . . .

http://www.nytimes.com/2012/07/31/s...rds-to-seals-is-studied-for-human-threat.html
 
Re: New bird flu virus killing US baby seals (H3N8)

New flu virus found in seals concerns scientists

BBC take on the same story.


Carries a little more info on changed receptor binding specificity.


"It's something that's been circulating for a while in birds, but we've not had this sort of die off relating to this virus in the past. As we've looked at it in some detail, we've found there have been mutations in this virus which enable it to bind to both bird receptors for flu as well as mammalian receptors for flu."

The NYT article had an MBio link but I could not find the paper - full text or abstract - if anyone has a link please add it. Thanks.

Edit
Please also see this FT thread by Mingus pulling together the available data on
The H7N7 Seal epidemic of 1979-1980
 
Re: New bird flu virus killing US baby seals (H3N8)

[Source: mBio, full text: (LINK). Abstract, edited.]
Emergence of Fatal Avian Influenza in New England Harbor Seals


S. J. Anthony<SUP>a,b</SUP>, J. A. St. Leger<SUP>c</SUP>, K. Pugliares<SUP>d</SUP>, H. S. Ip<SUP>e</SUP>, J. M. Chan<SUP>f</SUP>, Z. W. Carpenter<SUP>f</SUP>, I. Navarrete-Macias<SUP>a</SUP>, M. Sanchez-Leon<SUP>a</SUP>, J. T. Saliki<SUP>g</SUP>, J. Pedersen<SUP>h</SUP>, W. Karesh<SUP>b</SUP>, P. Daszak<SUP>b</SUP>, R. Rabadan<SUP>f</SUP>, T. Rowles<SUP>i</SUP>, and W. I. Lipkin<SUP>a</SUP>

Author Affiliations: Center for Infection and Immunity, Mailman School of Public Health, Columbia University, New York, New York, USA<SUP>a</SUP>; EcoHealth Alliance, New York, New York, USA<SUP>b</SUP>; SeaWorld, San Diego, California, USA<SUP>c</SUP>; New England Aquarium, Boston, Massachusetts, USA<SUP>d</SUP>; National Wildlife Health Center, United States Geological Survey, Madison, Wisconsin, USA<SUP>e</SUP>; Center for Computational Biology and Bioinformatics, Department of Biomedical Informatics, Columbia University, New York, New York, USA<SUP>f</SUP>; Athens Veterinary Diagnostic Laboratory, University of Georgia, Athens, Georgia, USA<SUP>g</SUP>; National Veterinary Services Laboratory, United States Department of Agriculture, Washington, DC, USA<SUP>h</SUP>; and National Oceanic and Atmospheric Administration, Washington, DC, USA<SUP>i</SUP>
<SUP></SUP>
Address correspondence to S. J. Anthony, sja2127@columbia.edu, or W. I. Lipkin, wil2001@columbia.edu; for questions on computational modeling, contact R. Rabadan, rabadan@dbmi.columbia.edu.

Editor Anne Moscona, Weill Medical College, Cornell University



ABSTRACT

From September to December 2011, 162 New England harbor seals died in an outbreak of pneumonia. Sequence analysis of postmortem samples revealed the presence of an avian H3N8 influenza A virus, similar to a virus circulating in North American waterfowl since at least 2002 but with mutations that indicate recent adaption to mammalian hosts. These include a D701N mutation in the viral PB2 protein, previously reported in highly pathogenic H5N1 avian influenza viruses infecting people. Lectin staining and agglutination assays indicated the presence of the avian-preferred SAα-2,3 and mammalian SAα-2,6 receptors in seal respiratory tract, and the ability of the virus to agglutinate erythrocytes bearing either the SAα-2,3 or the SAα-2,6 receptor. The emergence of this A/harbor seal/Massachusetts/1/2011 virus may herald the appearance of an H3N8 influenza clade with potential for persistence and cross-species transmission.



IMPORTANCE


The emergence of new strains of influenza virus is always of great public concern, especially when the infection of a new mammalian host has the potential to result in a widespread outbreak of disease. Here we report the emergence of an avian influenza virus (H3N8) in New England harbor seals which caused an outbreak of pneumonia and contributed to a U.S. federally recognized unusual mortality event (UME). This outbreak is particularly significant, not only because of the disease it caused in seals but also because the virus has naturally acquired mutations that are known to increase transmissibility and virulence in mammals. Monitoring the spillover and adaptation of avian viruses in mammalian species is critically important if we are to understand the factors that lead to both epizootic and zoonotic emergence.



Footnotes
  • S.J.A. and J.A.S.L. contributed equally to the study.
  • T.R. and W.I.L. are joint senior authors.
  • Citation Anthony SJ, et al. 2012. Emergence of fatal avian influenza in New England harbor seals. mBio 3(4):e00166-12. doi:10.1128/mBio.00166-12.
  • Received 31 May 2012
  • Accepted 29 June 2012
  • Published 31 July 2012
  • Copyright ? 2012 Anthony et al.
This is an open-access article distributed under the terms of the Creative Commons Attribution-Noncommercial-Share Alike 3.0 Unported License, which permits unrestricted noncommercial use, distribution, and reproduction in any medium, provided the original author and source are credited.
- -----
 

Attachments

Re: New bird flu virus killing US baby seals (H3N8)

http://www.ncbi.nlm.nih.gov/nuccore/JQ433876

and the 7 following numbers for other segments

Code:
number of amino acid differences to the mallard-index in the 8 segments :

                                            1   2   3   4   5   6   7   8
--------------------------------------------------------------------------
>A/Index/birds/2000(H3N8a)                  0,  0,  0,  0,  0,  0,  0,  0
>A/blue-winged teal/Ohio/926/2002/09/07     0,  1,  4, 19,  4, 10,  3,  1
>A/green-winged teal/Ohio/960/2002/09/07    3,  3,  8, 16,  6, 14,  1,  2
>A/harbor seal/Massachusetts/1/2011/09/     6,  9,  6, 24,  6, 25,  2,  1
>A/mallard/Ohio/649/2002,2002/08/19         4,  2, 10, 17,  5, 11,  0,  1
>A/mallard/Ohio/651/2002,2002/08/19         4,  2, 10, 17,  5, 11,  0,  1
>A/mallard/Ohio/654/2002,2002/08/19         3,  2, 10, 17,  6, 11,  1,  1
>A/equine/Miami/1/1963(H3N8)                8, 12, 14, 55, 15, 63,  1, 10
>A/equine/Gansu/7/2008(H3N8)               18, 27, 40, 75, 29, 75, 10, 30
-------------------------------------------------------------------------
                                            1   2   3   4   5   6   7   8




nucleotide differences in promille:

Code:
  1 >A/blue-winged teal/Ohio/926/2002,2002/09/07,H3N8,USA    2280 2274 2151 1701 1469 1413  982  838   
  1:  0,  0,  0,  0,  0,  0,  0,  0   A/blue-winged teal/Ohio/926/2002,2002/09/07,H3N8,USA    2280 2274 2151 1701 1469 1413  982  838
  2: 58, 45,114, 18, 61, 68, 18, 33   A/green-winged teal/Ohio/960/2002,2002/09/07,H3N8,USA   2280 2274 2151 1701 1469 1413  982  836
  3: 56, 46,114, 19, 61, 51, 33, 29   A/mallard/Ohio/649/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  4: 56, 46,114, 19, 61, 51, 34, 29   A/mallard/Ohio/651/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  5: 56, 46,114, 19, 61, 51, 34, 29   A/mallard/Ohio/654/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  6: 32, 56, 19, 39, 51, 41, 17, 28   A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA    2280 2274 2151 1701 1497 1413  982  838
  7:100,155,137,223,136,222, 47, 66   A/equine/Miami/1/1963(H3N8)                             2280 2274 2151 1698 1497 1413  982  838
  8:120,169,156,226,157,229, 72, 95   A/equine/Gansu/7/2008(H3N8)                             2280 2274 2151 1698 1497 1413  982  838

  2 >A/green-winged teal/Ohio/960/2002,2002/09/07,H3N8,USA   2280 2274 2151 1701 1469 1413  982  836   
  1: 58, 45,114, 18, 61, 68, 18, 33   A/blue-winged teal/Ohio/926/2002,2002/09/07,H3N8,USA    2280 2274 2151 1701 1469 1413  982  838
  2:  0,  0,  0,  0,  0,  0,  0,  0   A/green-winged teal/Ohio/960/2002,2002/09/07,H3N8,USA   2280 2274 2151 1701 1469 1413  982  836
  3: 55, 52, 14, 22,  2, 69, 33,  3   A/mallard/Ohio/649/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  4: 55, 52, 14, 22,  2, 69, 34,  3   A/mallard/Ohio/651/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  5: 54, 52, 14, 22,  3, 69, 34,  3   A/mallard/Ohio/654/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  6: 73, 42,121, 46, 68, 86, 23, 29   A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA    2280 2274 2151 1701 1497 1413  982  838
  7:106,156,142,224,138,227, 52, 66   A/equine/Miami/1/1963(H3N8)                             2280 2274 2151 1698 1497 1413  982  838
  8:126,166,158,225,157,230, 73,100   A/equine/Gansu/7/2008(H3N8)                             2280 2274 2151 1698 1497 1413  982  838

  3 >A/mallard/Ohio/649/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838   
  1: 56, 46,114, 19, 61, 51, 33, 29   A/blue-winged teal/Ohio/926/2002,2002/09/07,H3N8,USA    2280 2274 2151 1701 1469 1413  982  838
  2: 55, 52, 14, 22,  2, 69, 33,  3   A/green-winged teal/Ohio/960/2002,2002/09/07,H3N8,USA   2280 2274 2151 1701 1469 1413  982  836
  3:  0,  0,  0,  0,  0,  0,  0,  0   A/mallard/Ohio/649/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  4:  0,  0,  0,  0,  0,  0,  1,  0   A/mallard/Ohio/651/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  5:  0,  0,  0,  0,  0,  0,  1,  0   A/mallard/Ohio/654/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  6: 71, 60,120, 47, 68, 70, 36, 26   A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA    2280 2274 2151 1701 1497 1413  982  838
  7: 96,161,144,221,138,220, 50, 63   A/equine/Miami/1/1963(H3N8)                             2280 2274 2151 1698 1497 1413  982  838
  8:121,167,164,224,157,224, 69, 96   A/equine/Gansu/7/2008(H3N8)                             2280 2274 2151 1698 1497 1413  982  838

  4 >A/mallard/Ohio/651/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838   
  1: 56, 46,114, 19, 61, 51, 34, 29   A/blue-winged teal/Ohio/926/2002,2002/09/07,H3N8,USA    2280 2274 2151 1701 1469 1413  982  838
  2: 55, 52, 14, 22,  2, 69, 34,  3   A/green-winged teal/Ohio/960/2002,2002/09/07,H3N8,USA   2280 2274 2151 1701 1469 1413  982  836
  3:  0,  0,  0,  0,  0,  0,  1,  0   A/mallard/Ohio/649/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  4:  0,  0,  0,  0,  0,  0,  0,  0   A/mallard/Ohio/651/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  5:  0,  0,  0,  0,  0,  0,  2,  0   A/mallard/Ohio/654/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  6: 71, 60,120, 47, 68, 70, 37, 26   A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA    2280 2274 2151 1701 1497 1413  982  838
  7: 96,161,144,221,138,220, 50, 63   A/equine/Miami/1/1963(H3N8)                             2280 2274 2151 1698 1497 1413  982  838
  8:121,167,164,224,157,224, 69, 96   A/equine/Gansu/7/2008(H3N8)                             2280 2274 2151 1698 1497 1413  982  838

  5 >A/mallard/Ohio/654/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838   
  1: 56, 46,114, 19, 61, 51, 34, 29   A/blue-winged teal/Ohio/926/2002,2002/09/07,H3N8,USA    2280 2274 2151 1701 1469 1413  982  838
  2: 54, 52, 14, 22,  3, 69, 34,  3   A/green-winged teal/Ohio/960/2002,2002/09/07,H3N8,USA   2280 2274 2151 1701 1469 1413  982  836
  3:  0,  0,  0,  0,  0,  0,  1,  0   A/mallard/Ohio/649/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  4:  0,  0,  0,  0,  0,  0,  2,  0   A/mallard/Ohio/651/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  5:  0,  0,  0,  0,  0,  0,  0,  0   A/mallard/Ohio/654/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  6: 71, 60,120, 47, 69, 70, 37, 26   A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA    2280 2274 2151 1701 1497 1413  982  838
  7: 96,161,144,221,139,220, 51, 63   A/equine/Miami/1/1963(H3N8)                             2280 2274 2151 1698 1497 1413  982  838
  8:121,167,164,224,158,224, 70, 96   A/equine/Gansu/7/2008(H3N8)                             2280 2274 2151 1698 1497 1413  982  838

  6 >A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA    2280 2274 2151 1701 1497 1413  982  838   
  1: 32, 56, 19, 39, 51, 41, 17, 28   A/blue-winged teal/Ohio/926/2002,2002/09/07,H3N8,USA    2280 2274 2151 1701 1469 1413  982  838
  2: 73, 42,121, 46, 68, 86, 23, 29   A/green-winged teal/Ohio/960/2002,2002/09/07,H3N8,USA   2280 2274 2151 1701 1469 1413  982  836
  3: 71, 60,120, 47, 68, 70, 36, 26   A/mallard/Ohio/649/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  4: 71, 60,120, 47, 68, 70, 37, 26   A/mallard/Ohio/651/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  5: 71, 60,120, 47, 69, 70, 37, 26   A/mallard/Ohio/654/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  6:  0,  0,  0,  0,  0,  0,  0,  0   A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA    2280 2274 2151 1701 1497 1413  982  838
  7:103,163,139,223,131,231, 48, 61   A/equine/Miami/1/1963(H3N8)                             2280 2274 2151 1698 1497 1413  982  838
  8:123,168,164,224,157,234, 72, 95   A/equine/Gansu/7/2008(H3N8)                             2280 2274 2151 1698 1497 1413  982  838

  7 >A/equine/Miami/1/1963(H3N8)                             2280 2274 2151 1698 1497 1413  982  838   
  1:100,155,137,223,136,222, 47, 66   A/blue-winged teal/Ohio/926/2002,2002/09/07,H3N8,USA    2280 2274 2151 1701 1469 1413  982  838
  2:106,156,142,224,138,227, 52, 66   A/green-winged teal/Ohio/960/2002,2002/09/07,H3N8,USA   2280 2274 2151 1701 1469 1413  982  836
  3: 96,161,144,221,138,220, 50, 63   A/mallard/Ohio/649/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  4: 96,161,144,221,138,220, 50, 63   A/mallard/Ohio/651/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  5: 96,161,144,221,139,220, 51, 63   A/mallard/Ohio/654/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  6:103,163,139,223,131,231, 48, 61   A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA    2280 2274 2151 1701 1497 1413  982  838
  7:  0,  0,  0,  0,  0,  0,  0,  0   A/equine/Miami/1/1963(H3N8)                             2280 2274 2151 1698 1497 1413  982  838
  8: 61, 71, 72, 90, 62, 78, 38, 41   A/equine/Gansu/7/2008(H3N8)                             2280 2274 2151 1698 1497 1413  982  838

  8 >A/equine/Gansu/7/2008(H3N8)                             2280 2274 2151 1698 1497 1413  982  838   
  1:120,169,156,226,157,229, 72, 95   A/blue-winged teal/Ohio/926/2002,2002/09/07,H3N8,USA    2280 2274 2151 1701 1469 1413  982  838
  2:126,166,158,225,157,230, 73,100   A/green-winged teal/Ohio/960/2002,2002/09/07,H3N8,USA   2280 2274 2151 1701 1469 1413  982  836
  3:121,167,164,224,157,224, 69, 96   A/mallard/Ohio/649/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  4:121,167,164,224,157,224, 69, 96   A/mallard/Ohio/651/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  5:121,167,164,224,158,224, 70, 96   A/mallard/Ohio/654/2002,2002/08/19,H3N8,USA             2280 2274 2151 1701 1469 1413  982  838
  6:123,168,164,224,157,234, 72, 95   A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA    2280 2274 2151 1701 1497 1413  982  838
  7: 61, 71, 72, 90, 62, 78, 38, 41   A/equine/Miami/1/1963(H3N8)                             2280 2274 2151 1698 1497 1413  982  838
  8:  0,  0,  0,  0,  0,  0,  0,  0   A/equine/Gansu/7/2008(H3N8)                             2280 2274 2151 1698 1497 1413  982  838



Code:
best matches nucleotide-differences:


difference in promille
-----differences
----------common nucleotides
---------------number in database
--------------------name,isolation date,serotype,country

segment 1:
   0    0 2280    6 >A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA
 131   30 2280 3954 >A/mallard/Alberta/115/2007,2007/08/22,mixed,Canada
 133   30 2243 4983 >A/northern pintail/CA/44249-053/2006,2006/10/21,H5N2,USA
 135   31 2280 4098 >A/mallard/Alberta/76/2006,2006/07/26,H1N3,Canada
 135   31 2280 5215 >A/northern shoveler/Washington/44249-645/2006,2006/11/04,H5N2,USA
 140   32 2280 3984 >A/mallard/Alberta/156/2007,2007/08/22,mixed,Canada
 149   34 2280 3955 >A/mallard/Alberta/11513/2005(mixed),2005/08/03,mixed,Canada

segment 2:
   0    0 2274    6 >A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA
 158   36 2274 4010 >A/blue-winged teal/Minnesota/Sg-00028/2007,2007/08/02,H4N6,USA
 158   36 2274 4020 >A/blue-winged teal/Minnesota/Sg-00038/2007,2007/08/03,H4N6,USA
 162   37 2274 3549 >A/American green-winged teal/Manitoba/23884/2007,2007/08/21,H4N6,Canada
 162   37 2274 4012 >A/blue-winged teal/Minnesota/Sg-00030/2007,2007/08/03,H4N6,USA
 162   37 2274 4013 >A/blue-winged teal/Minnesota/Sg-00031/2007,2007/08/03,H4N6,USA
 162   37 2274 4017 >A/blue-winged teal/Minnesota/Sg-00035/2007,2007/08/03,H4N6,USA
 162   37 2274 4021 >A/blue-winged teal/Minnesota/Sg-00039/2007,2007/08/03,H4N6,USA
 162   37 2274 4025 >A/blue-winged teal/Minnesota/Sg-00043/2007,2007/08/03,H4N6,USA
 162   37 2274 4034 >A/mallard/Minnesota/Sg-00052/2007,2007/08/03,H4N6,USA
 162   37 2274 4041 >A/mallard/Minnesota/Sg-00060/2007,2007/08/03,Mixed,USA
 162   37 2274 4058 >A/blue-winged teal/Texas/Sg-00081/2007,2007/09/15,H4N6,USA
 162   37 2274 4229 >A/mallard/Minnesota/Sg-00198/2007,2007/09/22,H11N9,USA

segment 3:
   0    0 2151    6 >A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA
  92   20 2151 6487 >A/northern shoveler/Illinois/08OS3331/2008,2008/11/15,H4N8,USA
  92   20 2151 7219 >A/mallard/Alberta/27/2007,2007/08/18,H3N8,Canada
  92   20 2151 7220 >A/mallard/Alberta/28/2007,2007/08/18,H3N8,Canada
  92   20 2151 7221 >A/mallard/Alberta/34/2007,2007/08/18,H3N8,Canada
  97   21 2151 5593 >A/green-winged teal/Alberta/11383/2005,2005/07/31,H4N6,Canada
 111   24 2151 7190 >A/mallard/Alberta/66/2005,2005/07/27,H4N6,Canada
 130   28 2151 5459 >A/mallard/Minnesota/Sg-00464/2008,2008/09/16,H6N1,USA
 130   28 2151 5478 >A/mallard/Minnesota/Sg-00576/2008,2008/09/17,H6N1,USA
 134   29 2151 5458 >A/mallard/Minnesota/Sg-00462/2008,2008/09/16,H6N1,USA
 144   31 2151 7169 >A/mallard/Alberta/192/2004,2004/08/13,H3N1,Canada

segment 4:
   0    0 1701    6 >A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA
 221   37 1673  153 >A/blue-winged teal/North Dakota/Sg-00746/2008,2008/09/07,H3N8,USA
 223   38 1701  534 >A/mallard/Illinois/2956/2009,2009/10/17,mixed,H3,USA
 229   39 1701  472 >A/mallard/Alberta/192/2004,2004/08/13,H3N1,Canada
 235   24 1019  634 >A/mallard/Minnesota/Sg-00571/2008,2008/08/03,H3N4,USA
 235   40 1701  677 >A/mallard/Ohio/1506/2006,2006//,H3N6,USA

segment 5:
   0    0 1497    6 >A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA
 113   17 1497 3921 >A/American black Dk/Wisconsin/2542/2009,2009/10/05,H4N2,USA
 126   19 1497 4247 >A/blue-winged teal/Texas/Sg-00208/2007,2007/09/16,mixed,USA
 140   21 1497 4258 >A/blue-winged teal/Wisconsin/3060/2009,2009/10/17,H3N2,USA
 140   21 1497 4550 >A/Dk/Ohio/470655/2007,2007//,H5N2,USA
 140   21 1497 5583 >A/mallard/Missouri/MO130/2005,2005//,H11N3,USA
 140   21 1497 5801 >A/mallard/Wisconsin/3165/2009,2009/10/31,H1N1,USA
 146   22 1497 4624 >A/green winged teal/Ohio/468160/2006,2006//,H5N2,USA

segment 6:
   0    0 1413    6 >A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA
 155   22 1413   27 >A/American green-winged teal/Wisconsin/08OS2270/2008,2008/10/19,H3N8,USA
 197   27 1369  498 >A/mallard/Minnesota/Sg-00804/2008,2008/09/01,H3N8,USA
 198   28 1413  604 >A/northern shoveler/Illinois/08OS3331/2008,2008/11/15,H4N8,USA
 212   30 1413  363 >A/mallard/Alberta/527/2008,2008/08/08,H3N8,Canada
 219   31 1412  445 >A/mallard/Minnesota/Sg-00103/2007,2007/09/16,H3N8,USA

segment 7:
   0    0  982    6 >A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA
  91    9  981 7129 >A/ruddy turnstone/Delaware Bay/290/2006,2006/05/22,H7N4,USA
  91    9  982 5305 >A/laughing gull/Delaware Bay/50/2006,2006/05/22,H7N3,USA
  91    9  982 5306 >A/laughing gull/Delaware Bay/6/2006,2006/05/22,H7N3,USA
  91    9  982 7030 >A/red knot/New Jersey/253/2006,2006//,H7N3,USA
  91    9  982 7031 >A/red knot/New Jersey/96/2006,2006//,H7N3,USA
  91    9  982 7128 >A/ruddy turnstone/Delaware Bay/285/2006,2006/05/22,H7N3,USA
  91    9  982 7252 >A/ruddy turnstone/New Jersey/166/2006,2006//,H7N3,USA
  91    9  982 7329 >A/sanderling/New Jersey/125/2006,2006//,H7N3,USA
  91    9  982 7415 >A/shorebird/Delaware Bay/332/2006,2006/05/23,H7N3,USA
 101   10  982 4470 >A/avian/Delaware Bay/226/2006,2006/05/22,H7N3,USA
 101   10  982 6156 >A/mallard/Minnesota/Sg-00046/2007,2007/08/03,Mixed,USA
 101   10  982 6165 >A/mallard/Minnesota/Sg-00056/2007,2007/08/03,H10N7,USA
 101   10  982 6166 >A/mallard/Minnesota/Sg-00057/2007,2007/08/03,H10N7,USA
 101   10  982 6210 >A/mallard/Minnesota/Sg-00195/2007,2007/09/22,H10N3,USA

segment 8:
   0    0  838    6 >A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA
  59    5  838 5428 >A/Dk/OH/492493/2007,2007/04/,H2N3,USA
  71    6  838 3743 >A/blue-winged teal/Texas/Sg-00081/2007,2007/09/15,H4N6,USA
  71    6  838 4518 >A/northern shoveler/CA/HKWF392sm/2007,2007/11/03,H10N7,USA
  71    6  838 5409 >A/Ck/OH/494832/2007,2007/04/,H2N3,USA
  83    7  838 3606 >A/American green-winged teal/CA/44363-002/2007,2007/10/20,H11N5,USA
  83    7  838 3706 >A/blue-winged teal/Minnesota/Sg-00028/2007,2007/08/02,H4N6,USA
  83    7  838 3717 >A/blue-winged teal/Minnesota/Sg-00041/2007,2007/08/03,Mixed,USA
  83    7  838 3749 >A/blue-winged teal/Texas/Sg-00158/2007,2007/09/15,H4N6,USA
  83    7  838 3754 >A/blue-winged teal/Texas/Sg-00207/2007,2007/09/15,H4N6,USA
  83    7  838 3884 >A/green-winged teal/Ohio/1324/2005,2005//,H4N6,USA
  83    7  838 3885 >A/green-winged teal/Ohio/1324/2005,2005//,H4N6,USA
  83    7  838 4258 >A/mallard/Minnesota/Sg-00058/2007,2007/08/03,H4N6,USA
  83    7  838 4259 >A/mallard/Minnesota/Sg-00063/2007,2007/08/03,H4N6,USA
  83    7  838 4261 >A/mallard/Minnesota/Sg-00104/2007,2007/09/16,H6N1,USA
  83    7  838 4265 >A/mallard/Minnesota/Sg-00164/2007,2007/09/14,H3N8,USA
  83    7  838 4304 >A/mallard/Ohio/1695/2009,2009/08/25,H4N6,USA
  83    7  838 4478 >A/northern pintail/Saskatchewan/22910/2007,2007/08/10,H3N2,Canada
  83    7  838 4523 >A/northern shoveler/CA/HKWF96/2007,2007/10/24,H10N7,USA
  83    7  838 4531 >A/northern shoveler/Mississippi/252/2010,2010/01/10,H10N7,USA
  83    7  838 5549 >A/mallard/Illinois/08OS2315/2008,2008/10/25,H4N6,USA
  83    7  838 5618 >A/mallard/Minnesota/Sg-00052/2007,2007/08/03,H4N6,USA



Code:
                                                       0000000000000000000000000000000000000000 0000000000000000000000000000000000000000000 0000000000000000000000000000000000000000000000000000000000 00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 0000000000000000000000000000000000000000000000 0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 000000000000000000000000 00000000000000000000000000000000000000 
                                                       0000111111222333334444555555555666667777 0001111111111222223333333333444445566666677 0000000000011112222222222222333333333333444445555556666677 00000000000000000000000000000000000011111111111111111111112222222222222222233333333333333444445555555 0000000011111111222222333333333333344444444444 0000000000000000000000000000000000000000111111111222222222222222222223333333333333333333333333344444444 000001122222222223333333 00000000000001111111222222222222222233 
                                                       1166000149559446780477133567889112470016 5561115556779112690125777889235677811244535 1255666688901581113344666777123344458889035773345561268811 00000001111111112222234466777788899900011233555566677778990001123566778889901222244467789015890014456 1113455600112348458899011144555578904555578999 1111222233334444444456666677777788888999024667999000113335555666666880001112234455777888899999911335557 128892603356666770033345 24444567788891357789001112222336669925 
                                                       2605589479159049628658109975680357961250 4914894574458451189799567367907436748125488 3857123456908843671714159027226735832781070692452454653967 23456890123456890125671624124913637934808778136901245698583592438808673782456056804731285368055991377 0263102305178666573636523945137944766023632689 3789023601780123467991236902678901248123957014189159133570238012568391261390191259346136903467956241241 520551281434579131315821 74578970146862961864793460378014561403 
                                                       ---------------------------------------- ------------------------------------------- ---------------------------------------------------------- ----------------------------------------------------------------------------------------------------- ---------------------------------------------- ------------------------------------------------------------------------------------------------------- ------------------------ -------------------------------------- 
                                                       STDETTVVIARVRRVRKIDFLVVTITDMKAGVIEVTDKN KTTVRVGLAIMDKKRASLWMQSNIDERIKREDVLAEEQNVSE IPDRIIVETMGVIKSRDQAECGLPRLDSKILAALIKEVSKSHVADLPITIVNKLLAK KTIIVSYLFCLALSDYSGSSTPITSTPHIDTILDDTYVSFVLITGNKPASGGSAVDVVTQNVARWVVIMRIDATIPIAVKSPTLIHQAGKSSNEDDKFLR YQGVISYIRVYRDLAVSILARYRVFNSSRVQSMRNIRSRPVNSYN ILVVLILITVPGGNNGSNEVVKVTHNVERPESGHFNADAKRTVEIAIAKVHITVQEFQRAQKIIAESEVVLPRGLPSMNQNMVLVVNEKRVVNLWRNEKEID VAVNRTHQDLTRGEKSFCQSDG LRGGSRREEVAREADIDIEVNDPLPRAESVTQFSGI 
>A/Index/birds/2000(H3N8a)                             .......................................} ..........................................} .........................................................} ....................................................................................................} .............................................} ......................................................................................................} ..........}............} ..............................}......} 
>A/blue-winged teal/Ohio/926/2002,2002/09/07,H3N8,USA  .......................................} .................V........................} ..........................E............RQ......V.........} .A....CF....F.NP.ENN...........V......N......G..TN....L.....S....I..............N................L..} T........M...........................N..M....} V........I...................S..D.....V.................Y.......V.............S...I.............D.....} ......Q...}I...R.......} ............................P.}......} 
>A/green-winged teal/Ohio/960/2002,2002/09/07,H3N8,USA .............K.......I.............A...} .S............K.......S...................} ........................K.........L..IG.P......V..I.R....} ......CF....F.NP.EDN...........M......N......G..TN....L.....S....I..................................} T........M.....I...................V.N....N..} V........I.............I.......GD...P................I..Y.K...V.T.....V.......S...I...................} ..........}....R.......} MK............................}......- 
>A/mallard/Ohio/649/2002,2002/08/19,H3N8,USA           ...........D.........I..........V.I....} ..........................K........D......} ........................K.........L..IG.P.....SV..ISR....} ......CF....F.NP.ENN...........M......N......G..TN....L.....S....I.............................G....} T........M.........................V.N....N..} V........I......N...I...........D.......K...............Y......VT............V....I...................} ..........}............} M.............................}......} 
>A/mallard/Ohio/651/2002,2002/08/19,H3N8,USA           ...................S.I..........V.I....} ..........................K........D......} ........................K.........L..IG.P.....SV..ISR....} ......CF....F.NP.ENN...........M......N......G..TN....L.....S....I.............................G....} T........M.........................V.N....N..} V........I......N...I...........D.......K...............Y......VT............V....I...................} ..........}............} M.............................}......} 
>A/mallard/Ohio/654/2002,2002/08/19,H3N8,USA           .....................I..........V.I....} ..........................K........D......} ........................K.........L..IG.P.....SV..ISR....} ......CF....F.NP.ENN...........M......N......G..TN....L.....S....I.............................G....} TL.......M.........................V.N....N..} V........I......N...I...........D.......K...............Y......VT............V....I...................} .T........}............} M.............................}......} 
>A/harbor seal/Massachusetts/1/2011,2011/09/,H3N8,USA  ..N.....M.......RV...I..............N..} .S.....M..I.......G..GSVG......E..........} ........A.....N........L..E............RQ................} ......CF....FCNP.ENN..........KM.......S....EG...N...VL.........LIMV...N..............K...L.........} .......V.M..GM.......H..............G........} V...I.I.II.............I.....S..DQ....V...E...........L.Y.......V..D.....R.S.V....I...T.....D.R.DA..V.} ..........}.K..R.......} ...........H..................}......} 
>A/Brevig Mission/1/1918(H1N1)                         .....A.I.S..........M...V.N......K...R.} R.....................S..D......LI.....MN.} .LN........A........Y.......RV......D...L.......S.......R} E---------------------------------------------------------------------------------------------------- ..DI....IM...M....P.....Y.....K..........S...} ------------------------------------------------------------------------------------------------------- .....A...I}..EGRN..K...} .......K.........V...N.....K..}...N..} 
>A/equine/Miami/1/1963(H3N8)                           .I.G...........G..N....I.I..R.......N..} ......D.S..N.RK.R.....S..DK.RK........S...} ...LV.I...R......H.......IG...Q...L..I..A........V...I.S.} ..TTIIL.THWVH.NPT.G-RAL.T..YVN..MNYNFI....MA.SRS.DSE.ST.II.NK..K..M.......V.VK...QIIVY.....A....R.IK} ....V.H..M.M.MT.G.....K....NK..AI....N.S...F.} A..I.VIVI.SN.TGPN.GI.RI.Y.I.E.SNEYYSPE.Q.L..V.V.Q..VV.KDY..IDR..TDN.....T.I.TLS..AIIIT.DRKI....KG.IKVS} ........N.}............} ............D.EVN...HNSF......}..L.E.} 
>A/equine/Gansu/7/2008(H3N8)                           L...A.I.V.KIK.M.......II.I.IRTSA....N.K} ..IIKM..SM.NRRKTR..IR.S.EDKVRKG...T.DKS..D} V.NLVVID.IRAVR.KNYVK.SS.KMGH..QTEILR.I..TYITEF...V..R.IS.} ..T.IIL.THW.Y.NPISN-RALSIMSY.N..M.YNFI..IITARG.S.DS.NSTKIIS.KIEK.IMVLKV.VIVSVKIRN.IIVY.TER.AGGY...IK} ..D.VNH.KMHM.IT.GT.TK.KI.KLNKI.AIKS...KS...FS} AILIIVIVI.NNETGLNKGI..I..SAK..PNEYY.PE.Q.S.K.S.NQIN.VIKNYK.IDRV.TD..II.ST.I.TL.KTAIIIT.DR.IIDP.KG.TK.S} I.ISK..K..}......SF.NSS} ..RSIHQ.KIT.DTEVN.KIHNSFS}EKPI}IRL.EN}
 
Re: New bird flu virus killing US baby seals (H3N8)

I'd list these amino-acid mutations with mammalean character:
(also seen in other mammalean flu)

D701N(1)
N375S(2)
V260M(4)
I268V(4)
L20I(6)
L23I(6)
T30I(6)
N396D(6)
I452V(6)
 
Re: New bird flu virus killing US baby seals (H3N8)

hat tip Jason Anthony Tetro
@JATetro (twitter account)

Also please see:

The appearance of H3 influenza viruses in seals
R. J. Callan, ~* G. Early, 2 H . Kida 3 and V. S. H i n s h a w ~

1 Department of Pathobiological Sciences, and Animal Health and Biomedical Sciences, School of Veterinary
Medicine, University of Wisconsin, Madison, WI 53706, 2 New England Aquarium, Boston, MA 02109, USA
and 3 School of Veterinary Medicine, Hokkaido University, Sapporo 060, Japan


snip

The repeated isolation of influenza viruses from seals indicates that this species is susceptible to infection with influenza viruses, and in each case the viruses appear to originate from an avian reservoir.

The detection of four different influenza subtypes (H7N7, H4N5, H4N6 and H3N3) indicates that seals could play a role in genetic reassortment between influenza viruses.

Viruses capable of infecting and replicating in seals may be more adapted to mammalian than to avian hosts. The possibility of genetic reassortment, along with the potential for interspecies transmission, emphasizes the importance of continued surveillance of influenza viruses in seals.

http://vir.sgmjournals.org/content/76/1/199.full.pdf
 
Back
Top Bottom