• FluTrackers.com Inc. does not provide medical advice. Information on this web site is collected from various internet resources, and the FluTrackers board of directors makes no warranty to the safety, efficacy, correctness or completeness of the information posted on this site by any author or poster. The information collated here is for instructional and/or discussion purposes only and is NOT intended to diagnose or treat any disease, illness, or other medical condition. Every individual reader or poster should seek advice from their personal physician/healthcare practitioner before considering or using any interventions that are discussed on this website. By continuing to access this website you agree to consult your personal physican before using any interventions posted on this website, and you agree to hold harmless FluTrackers.com Inc., the board of directors, the members, and all authors and posters for any effects from use of any medication, supplement, vitamin or other substance, device, intervention, etc. mentioned in posts on this website, or other internet venues referenced in posts on this website.
  • We are not asking for any donations. Do not donate to any entity who says they are raising funds for us.

Four-year-old Egyptian girl has bird flu

Re: Four-year-old Egyptian girl has bird flu

with H5N1 showing simalarties to the 1918 pandemic virus,is worrrying.
 
Re: Four-year-old Egyptian girl has bird flu

Machine-translated from Arabic:

The transfer of injured 36 by the bird flu to Al Bakri's facility hospital ..And a new suspicion condition in Qina
June 13, 2007

Tarek Amin and Mohamed Hamdi wrote

Doctor Abdul Rahman Shahin, the official spokesman of the Ministry of Health, said that the referral of child Dina Ali Tghyan took place "4 years" that fixed its injury by the bird flu to Al Bakri's facility hospital in Cairo for the follow-up of its health condition.

And Shahin pointed out that the child who stays in Aboudiab village in west of Dshna district in Qena Governorate is the injury condition a number 36 by the disease, and has entered the hospital of Qina fevers last Sunday [June 10], and she suffers from a rise in the temperature, a boredom with the respiration and a pneumonia after its confrontation with birds suspected in its injury by the disease, explaining that its giving the necessary medicine took place, and its health condition stable and the neighbour of the work of the epidemic investigation to all family individuals.

To that the hospital of Qina fevers was detained yesterday Hammouda Mohamed Omar from Aboudiab village in west of Dshna, for the suspicion of its injury by the bird flu disease, and it holds the analyses now to make sure of its injury by the disease from its lack.

From its side, the major general Magdi Ayoub, Qina governor, decided the ban of the birds entrance from and to the governorate with the confiscation of cars that is being seized are laden with the smuggled birds from the neighboring governorates, assuming that a veterinarian is present with each ambush in the governorate.

And Ayoub threatened with deposition of any village president that shows in his village foci injured by the bird flu disease, and demanded from them the residence in the streets and the follow-up of situation in the field, dr.

And the Egyptian doctor Mohamed Diaa confirmed, the Ministry of Health deputy in Qena Governorate, that he until now defining the real reason behind the spread of the bird flu virus in Qena Governorate, specially that all domestic farms under observation and the control, pointing out to that pointing out that the real reason may be the random aviculture in the houses or smuggled birds from other governorates.

http://www.almasry-alyoum.com/article.aspx?ArticleID=64490
 
Re: Four-year-old Egyptian girl has bird flu

AVIAN INFLUENZA, HUMAN (98): EGYPT
***********************************
It
is true that Egypt is located on a major bird migration route, but
one must not automatically assume that migratory birds, and not
movement of domestic poultry, are responsible for the introduction of
the virus into the country.
A map of Egypt can be accessed at:
<http://www.lib.utexas.edu/maps/africa/egypt_pol97.jpg>.
- Mod.TY]

Propaganda by ProMed continues. Qinghai H5N1 was in Nile Delta in HEALTHY teal on December, 2005.

The story is in the sequence, and it appears that no one at ProMed, over 2 years after Qinghai, can read an H5N1 sequences.

Truly embarrassing.
 
Re: Four-year-old Egyptian girl has bird flu

http://www.recombinomics.com/News/11170602/H5N1_Teal_Egypt.html

H5N1 Wild Bird Sequences in Egypt
Recombinomics Commentary
November 17, 2006

HA sequences from H5 isolated from wild birds in Egypt have been released. Although Egypt reported H5N1 to the OIE in February of this year, the two new sequences indicate H5N1 was isolated in a teal in December, 2005. The HA sequence from that isolate, A/teal/Egypt/14051-NAMRU3/2005, is the Qinghai strain, with the common HA cleavage site, GERRRKKR.
 
Re: Four-year-old Egyptian girl has bird flu

LOCUS EF042624 1596 bp cRNA linear VRL 15-NOV-2006
DEFINITION Influenza A virus (A/teal/Egypt/14051-NAMRU3/2005(H5N1))
hemagglutinin (HA) gene, partial cds.
ACCESSION EF042624
VERSION EF042624.1 GI:117395044
KEYWORDS .
SOURCE Influenza A virus (A/teal/Egypt/14051-NAMRU3/2005(H5N1))
ORGANISM Influenza A virus (A/teal/Egypt/14051-NAMRU3/2005(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1596)
AUTHORS Saad,M.D., Gamal-Eldein,M.A., Ahmed,L.S., Yingst,S.L., Parker,M.A.
and Monteville,M.R.
TITLE Possible Introduction of Avian Influenza H5N1 in Egypt by a
Migratory Bird
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1596)
AUTHORS Saad,M.D., Gamal-Eldein,M.A., Ahmed,L.S., Yingst,S.L., Parker,M.A.
and Monteville,M.R.
TITLE Direct Submission
JOURNAL Submitted (04-OCT-2006) Viral and Zoonotic Diseases Research
Program, U.S. Naval Medical Research Unit No. 3, Extension of
Ramses Street, Nasr City, Cairo 11517, Egypt
FEATURES Location/Qualifiers
source 1..1596
/organism="Influenza A virus
(A/teal/Egypt/14051-NAMRU3/2005(H5N1))"
/mol_type="viral cRNA"
/strain="A/teal/Egypt/14051-NAMRU3/2005"
/serotype="H5N1"
/isolation_source="cloacal swab"
/specific_host="teal duck"
/db_xref="taxon:409944"
/segment="4"
/country="Egypt: Damietta governorate"
/collection_date="Dec-2005"
gene <1..>1596
/gene="HA"
CDS <1..>1596
/gene="HA"
/codon_start=3
/product="hemagglutinin"
/protein_id="ABK34513.1"
/db_xref="GI:117395045"
/translation="YHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDGVKPL
ILRDCSVAGWLLGNPMCDEFLNVPEWSYIVEKINPANDLCYPGNFNDYEELKHLLSRI
NHFEKIQIIPKSSWSDHEASSGVSSACPYQGRSSFFRNVVWLIKKDNAYPTIKRSYNN
TNQEDLLVLWGIHHPNDAAEQTRLYQNPTTYISVGTSTLNQRLVPKIATRSKVNGQSG
RMEFFWTILKPNDAINFESNGNFIAPENAYKIVKKGDSTIMKSELEYGNCNTKCQTPI
GAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQGERRRKKRGLFGAIAGFI
EGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQFEAVGR
EFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQL
RDNAKELGNGCFEFYHRCDNECMESVRNGTYDYPQYSEEARLKREEISGVKLESIGTY
QILSIYSTVASSLALAIMVAGLS"
ORIGIN
1 gttaccatgc aaacaactcg acagagcagg ttgacacaat aatggaaaag aacgtcactg
61 ttacacacgc ccaagacata ctggaaaaga cacacaacgg gaaactctgc gatctagatg
121 gagtgaagcc tctaatttta agagattgta gtgtagctgg atggctcctc gggaacccaa
181 tgtgtgacga attcctcaat gtgccggaat ggtcttacat agtggagaag atcaatccag
241 ccaatgacct ctgttaccca gggaatttca acgactatga agaactgaaa cacctattga
301 gcagaataaa ccattttgag aaaattcaga tcatccccaa aagttcttgg tcagatcatg
361 aagcctcatc aggggtgagc tcagcatgtc cataccaggg aaggtcctcc ttttttagaa
421 atgtggtatg gcttatcaaa aaggacaatg crtacccaac aataaagaga agttacaata
481 ataccaacca agaagatctt ttggtactgt gggggattca ccatccaaat gatgcggcag
541 agcagacaag gctctatcaa aacccaacta cctatatttc cgttgggaca tcaacactaa
601 accagagatt agtaccaaaa atagctacta gatctaaggt aaacgggcaa agtggaagga
661 tggagttctt ttggacaatt ttaaaaccga atgatgcaat aaactttgag agtaatggaa
721 atttcattgc tccagaaaat gcatacaaaa ttgtcaagaa aggggactca acaattatga
781 aaagtgagtt ggaatatggt aactgcaaca ccaagtgtca aactccaata ggggcgataa
841 actctagtat gccattccac aacatccacc ctctcaccat cggggaatgc cccaaatatg
901 tgaaatcaaa cagattagtc cttgctactg ggctcagaaa cagccctcaa ggagagagaa
961 gaagaaaaaa gagaggacta tttggagcta tagcaggttt tatagaggga ggatggcagg
1021 gaatggtaga tggttggtat gggtaccacc atagcaacga gcaggggagt gggtacgctg
1081 cagacaaaga atccactcaa aaggcaatag atggagtcac caataaggtc aactcgatca
1141 ttgacaaaat gaacactcag tttgaggctg ttggaaggga atttaataac ttagaaagga
1201 gaatagaaaa tttaaacaag aagatggaag acggattcct agatgtctgg acttataatg
1261 ctgaacttct ggttctcatg gaaaatgaga gaactctaga ctttcatgac tcaaatgtca
1321 agaaccttta cgacaaggtc cgactacagc ttagggataa tgcaaaggag cttggtaacg
1381 gttgtttcga gttctatcac agatgtgata atgaatgtat ggaaagtgta agaaacggaa
1441 cgtatgacta cccgcagtat tcagaagaag caagattaaa aagagaggaa ataagtggag
1501 taaaattgga atcaatagga acttaccaaa tactgtcaat ttattcaaca gtggcgagct
1561 ccctagcact ggcaatcatg gtggctggtc tatctt
 
Re: Four-year-old Egyptian girl has bird flu

Note to ProMed:

Qinghai H5N1 was isolated in a healthy teal in the Nile Delta in December, 2005. At that time, EVERY country in western Europe, the Middle East, and Africa denied the presence of H5N1 (it was acknowledge in western Turkey and Romania).

At that time ProMed was still spreading the nonsense that H5N1 had not been found in a healthy wild bird, even though Russia had already published a partial sequence of H5N1 from a HEALTHY crested grebe, which had the common Qinghai HA cleavage site GERRRKKR.

In February, 2006, Egypt, along with MANY countries in western Europe, the Middle East, and Africa, acknowledged H5N1 for the FIRST TIME. ALL were the Qinghai strain.

The early 2006 isolates from Egypt, had additional regional markers showing the H5N1 was Qinghai, and was from Egypt, Israel, Gaza, or Djibouti. Those same markers were present in the 2007 human and bird isolates in Egypt, including the fatal case in Qena.

http://www.recombinomics.com/News/06120701/H5N1_Qena_Cluster.html

The blatant ProMed propaganda, in an infectious disease newsletter, continues to be an embarrassment to the scientific community.
 
Re: Four-year-old Egyptian girl has bird flu

LOCUS DQ190857 271 bp RNA linear VRL 27-SEP-2005
DEFINITION Influenza A virus (A/grebe/Novosibirsk/29/05(H5N1)) hemagglutinin (HA) gene, partial cds.
ACCESSION DQ190857VERSION DQ190857.1 GI:76097668
KEYWORDS .SOURCE Influenza A virus (A/grebe/Novosibirsk/29/2005(H5N1))
ORGANISM Influenza A virus (A/grebe/Novosibirsk/29/2005(H5N1)) Viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A.
REFERENCE 1 (bases 1 to 271) AUTHORS Lvov,D.K., Shchelkanov,M.Y., Deryabin,P.G., Grebennikova,T.V., Prilipov,A.G., Nepoklonov,E.A., Onishchenko,G.G., Vlasov,N.A., Aliper,T.I., Zaberezhny,A.D., Kireev,D.E., Krascheninnikov,O.P., Kiryukhin,S.T., Burtceva,E.I. and Slepuschkin,A.N.
TITLE Isolation of Influenza A/H5N1 virus strains from poultry and wild birds during epizootic outbreak in Western Siberia (July 2005) and their incorporation in Russian State Collection of Viruses (August 08, 2005)
JOURNAL Vopr. Virusol. (2005) In pressREFERENCE 2 (bases 1 to 271)
AUTHORS Lvov,D.K., Shchelkanov,M.Y., Deryabin,P.G., Grebennikova,T.V., Prilipov,A.G., Nepoklonov,E.A., Onishchenko,G.G., Vlasov,N.A., Aliper,T.I., Zaberezhny,A.D., Kireev,D.E., Krascheninnikov,O.P., Kiryukhin,S.T., Burtceva,E.I. and Slepuschkin,A.N.
TITLE Direct Submission JOURNAL Submitted (01-SEP-2005) Virus Evolution and Ecology, D.I. Ivanovski Virology Institute, 16 Gamalei Str., Moscow 123098, Russia
FEATURES Location/Qualifiers source 1..271 /organism="Influenza A virus (A/grebe/Novosibirsk/29/2005(H5N1))"
/mol_type="genomic RNA"
/strain="A/grebe/Novosibirsk/29/05"
/serotype="H5N1"
/isolation_source="great crested grebe (Podiceps cristatus) without clinical signs of influenza"
/db_xref="taxon:353252"
/country="Russia" /note="type: A" gene <1..>271
/gene="HA" CDS <1..>271
/gene="HA" /codon_start=3 /product="hemagglutinin" /protein_id="ABA39516.1"
/db_xref="GI:76097669"
/translation="INSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQGERRRK KRGLFGAIAGFIEGGWQGMVDGWYGYRHSNEQGSGYAADKESTQKA"

ORIGIN
1 tgataaattc tagcatgcca ttccacaaca tccaccctct caccatcggg gaatgcccca
61 aatatgtgaa atcaaacaga ttagtccttg cgactgggct tagaaatagc cctcaaggag
121 agagaagaag aaaaaagaga ggactatttg gagctatagc aggttttata gagggaggat
181 ggcagggaat ggtagatggt tggtatgggt accgccatag caacgagcag gggagtgggt
241 acgctgcaga caaagaatcc actcaaaagg c//




</PRE>
 
Re: Four-year-old Egyptian girl has bird flu

post #22 said:
To that the hospital of Qina fevers was detained yesterday Hammouda Mohamed Omar from Aboudiab village in west of Dshna, for the suspicion of its injury by the bird flu disease, and it holds the analyses now to make sure of its injury by the disease from its lack.
I hope 11 month old Hammouda Mohamed Omar is not Dina's brother (and that the authorities/press have failed to mention that). Here's a photo of Dina with, I'm guessing, her father and possibly a sibling -- the other child could be around 11 months, couldn't he? (But maybe Dina's not 4 in that picture.) Just speculating....

Dina and poss father & sibling.JPG
 
Re: Four-year-old Egyptian girl has bird flu

Commentary

H5N1 Cluster in Qena Egypt Raises Concerns
Recombinomics Commentary
June 12, 2007


Donia Ali Tghyan who did not exceed the second year from its age lies now in a non stable condition in Al Bakri's facility hospital, after a doctor that named Shehata Mahmoud suspected its condition inside his special clinic and accelerated its transfer to the hospital of Qina fevers.

And she Leone had entered it a week and left it without the suspicion of its condition or the necessary taking towards her and as a result to the non settlement of its condition and appearance of the injury symptoms on it clearly, have been transferred in a car prepared for Al Bakri's facility hospital.

The above translation suggests the latest confirmed H5N1 case (4F) in Qena, Egypt developed symptoms at the beginning of this month, like the recent fatal case (10F), although the situation update indicates she developed symptoms on June 7.

The translation, like media reports on the earlier case, indicates an H5N1 diagnosis was not made initially. The failure to diagnose these cases early is not a surprise because H5N1 cases this late in the season are unusual, and earlier cases in southern (upper) Egypt were mild. The confirmation of mild cases raised concerns, because such cases would be easily missed.

NAMRU-3 generated HA and NA sequences from the earlier cases. The HA sequences readily divided the cases into two sub-clades. Although all isolates had Qinghai markers as well as regional markers identified by isolates from Egypt, Israel, Gaza, and Djibouti in early 2006, the recent cases had a large number of sub-regional markers appended onto the genetic background defined by the isolates from early 2006. The grouping of these cases and geographical locations are listed below, including those with the 3 BP deletion. However, the two most recent isolates below had reverted to the wild type Qinghai cleavage site, and the patient that died this month had reverted 8 of the 14 sub-regional markers.

This rapid reversion raises concerns that the evolution of the H5N1 linked to mild cases may become more virulent. The latest fatality is the first child to die of H5N1 in Egypt and the mild nature of the earlier cases, coupled with the clustering in time and space, raises concerns that the number of H5N1 cases may be significantly higher than indicated in the confirmed totals.

Moreover, the two recent HA sequences that had reverted sub-regional markers did have N98D (N103D in H3 numbering), which was present in early H1N1 cases, including those from 1918.

Careful monitoring of this region is indicated.


3 BP deletion
A/Egypt/0636-NAMRU3/2007 Beni Suef
A/Egypt/1394-NAMRU3/2007 Fayoum
A/Egypt/2621-NAMRU3/2007 Qena
A/Egypt/2629-NAMRU3/2007 Qena
A/Egypt/2631-NAMRU3/2007 Qalubiea

Mongolian cleavage site
A/Egypt/2321-NAMRU3/2007 Aswan
A/Egypt/2331-NAMRU3/2007 Aswan
A/Egypt/2616-NAMRU3/2007 Aswan
A/Egypt/2620-NAMRU3/2007 Menia
A/Egypt/2750-NAMRU3/2007 Menia
A/Egypt/4081-NAMRU3/2007 Qena


.
 
Re: Four-year-old Egyptian girl has bird flu

Bird-flu patients Donia (4F) and Emad (4M) discharged from hospital (yay!).

Emad's father and twin siblings who were also hospitalized with flu-like symptoms test negative (the siblings were reported earlier, I believe -- although I wasn't aware that they were twins; didn't know Emad's father had been in hospital until now.)

Emad's initial symptoms included a high fever and severe headache.

Hat-tip to pugmom for finding this article! (Cross-posted in Emad thread.)


Machine-translated from Arabic:

After he followed up Ahram [the newspaper] every moment their tragedy is with the bird flu
Donia and Emad returned romping in their village again

July 1, 2007

Qina - from Osama Al Hawari:

My village peoples eyes stayed up Abu Diab west of in Dishna and the middle is Qamoula 'by his critics' [Banagadeh] yesterday evening till morning waiting of the arrival of their [two] children, Donia Ali Tghyan and Emad Mohamed Mohamed Al Daramalli after a therapeutic trip that reached the recovery of children from the bird flu, that the one that Ahram their conditions have followed up since the first hours from their disease and before the declaration of the central laboratories their injury.

With rings at three from yesterday's dawn he was Al Shawwan [Naga] hamlet in Abu Diab village west of on a non known date and he is the view of their daughter Donia Ali Nghyan the intervention of their hamlet Ali's [Ngian Njahm] livestock its feet and smiling the recovery accompanies it so that Al Zarid rushes that rejoiced over it after they went out of Al Ngh [Najah] same before 40 days in aid vehicle and in a serious condition extremely.

"The seriousness of a world" [Donia] was first who was keen she on its kissing and all started being entangled from around it joying with its return a safe once again after the worry was about to it is to defame all the one(s) who knows it.

As for the father of "the world" [Donia] of the simple farmer, he has confirmed to Ahram that he will not make forget at all that the country was keen on the life of his daughter more than him nevertheless he did not reduce the neglect size that its daughter was exposed to with the lag of its condition diagnosis despite its entrance to the hospital of Qina fevers.

As for Donia Wlti's mother she rushed inside the family house so that the women hands receive her there for her congratulation on the return of her daughter and they were content with making the trills as an expression of their happiness with it a safe.

Mahmoud Al Sayed said that he when he watched a world [Donia] brings out of its house that believed that it got out of the world but he did not believe his eyes when the child same opinion his house enters its feet and she romps and plays as was before.

And after nearly an hour and half the car that carried a world has stopped by its critics position so that the injured second condition declares Emad Al Daramalli's return the injured second condition and that its rescue of the vitality that the old child appeared on took place made the village peoples grant the continuous trills despite the approach of the dawn ears inside their village by the middle Qamoula [Balaust Kamula].

The child father said to Ahram delegate the recorded samples that have been taken who commemorated him a passivity came and that he is happy extremely with the recovery of his older son Emad and added that the media notifications were the main reason behind its early discovery to its son condition Emad who was mixing with house birds, it injured its considering by a severe headache and hotness condition have been transferred on its trace to the Fever Hospital after what doubted that its son is injured by the bird flu.

And Mohamed Mohamed Al Daramalli [Emad's father] child Emad's father said that he is he also that started suffering from the suspicion symptoms and have been reserved with Emad inside his critics fevers then by the fevers of Qina and the cadastral [smear] samples that have been taken from his son [Emad] have come a positive, while the sample related to him [the father] came a negative as the suspicion of its [his other] children took place the twin is Safaa and on a year and half nevertheless their cadastral [smear] samples came a passivity.

As for Sherifa Farag the judge child Emad's mother she has directed the thanks to the Ministry of Health on her severe care with the care of her son, that has been injured on Thursday before the last and its transfer of Qina adenoids took place on Friday and same evening today have been transferred to Al Bakri's facility hospital so that the team or the medical rescuer carry out the hospital thereafter in his injection with two drugs Lutami or the rescuer for the life then it took initial samples of it and a passivity came then another sample of the blood and the saliva was taken and came a passivity yesterday noon.

And there in the middle child Emad birthplace East Qamoula the happiness prevailed in all the village areas that include 16 hamlets that have lived in a severe fear after their discovery of the injury of their son Emad and before that it was suspected the injury of his father and its brothers the twin.

Child Emad's uncle claims Ahmed Al Saadi he said to Ahram that his brother has hidden the birds inside a wooden cage for fear of her execution by the veterinary medicine team who has the village's blockaded of a search about the birds.

The manager of Qina fevers accompanied the child until his exit

In a good gesture he took precautions to it as a doctor first and a father thereafter agreed Dr. Gamal Abdul Azim his critics fevers hospital manager Ali reserved the child Emad inside Al Bakri's facility hospital for 4 continuous days a rejecting that he leaves them before the reassurance of them and that after he threatened pillar father in his critics hospital with the referral of matter to the highest authorities if the reservation of child did not take place he is what pleased Emad's family with that good gesture from the hospital doctor.

http://www.ahram.org.eg/Index.asp?CurFN=inve3.htm&DID=9264
 
Re: Four-year-old Egyptian girl has bird flu

And after nearly an hour and half the car that carried a world has stopped by its critics position so that the injured second condition declares Emad Al Daramalli's return the injured second condition and that its rescue of the vitality that the old child appeared on took place made the village peoples grant the continuous trills despite the approach of the dawn ears inside their village by the middle Qamoula [Balaust Kamula].
Had a hard time earlier finding where in Qina Emad is from. Now we have this new placename -- Qamoula [Balaust Kamula] -- which I think must be El-Ausat Qamula. Here it is on a map -- and also Abu Dhi'ab which is where the other recently confirmed case from Qina, Donia/Dina (4F), is from. So, they don't live near to each other.

Qamula, Qina 2.JPG
 
Back
Top Bottom