Deadly bird flu strain found in Germany

HenryN · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

Fresh Outbreak of H5N1 Bird Flu in Germany



by Poonam Wadhwani - June 25, 2007 -

After a brief lull, H5N1 strain of bird flu is back in Germany. [COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]Health [/FONT][/FONT][FONT=Verdana, Arial, Helvetica, sans-serif][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]officials[/FONT][/color][/FONT][/color][/color] from the southern German city of Nuremberg confirmed late Sunday that eight dead birds discovered near two lakes in southern Germany were infected with the highly pathogenic [COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]bird [/FONT][/FONT][FONT=Verdana, Arial, Helvetica, sans-serif][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]flu [/FONT][/color][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]virus[/FONT][/color][/FONT][/color][/color] H5N1.
The bird flu virus had been discovered in the bodies of eight dead birds, the veterinary experts confirmed after examining the corpses of dead water-birds at the country’s top [COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]veterinary[/FONT][/FONT][/color][/color] laboratory, the Friedrich Loeffler Institute, on the island of Riems, marking the first cases of [COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]bird [/FONT][/FONT][FONT=Verdana, Arial, Helvetica, sans-serif][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]flu[/FONT][/color][/FONT][/color][/color] in Germany this year.
Among the dead birds found in two lakes in the Bavarian city of Nuremberg were swans, a [COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]duck[/FONT][/FONT][/color][/color] and a goose, the city of Nuremberg said in a statement.
“Over the next few days the city of Nuremberg will be supported by a federal epidemiological team which will scientifically investigate the causes and background of the infection cases,” the statement said.
After receiving the confirmation from the veterinary experts, the find was immediately notified to the European Commission.
According to the European Union executive, German authorities had informed [COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]Brussels[/FONT][/FONT][/color][/color] that laboratory tests carried out on dead water-birds at the regional laboratory in Bavaria had confirmed the lethal strain in the wild animals.
About 13 European Union member states, including Germany, Austria, Denmark, Italy, Greece, Britain, the [COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]Czech [/FONT][/FONT][FONT=Verdana, Arial, Helvetica, sans-serif][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]Republic[/FONT][/color][/FONT][/color][/color], Poland, Slovakia, Slovenia, Sweden, France and Hungary, last year, had confirmed cases of H5N1 bird flu virus.
“Highly pathogenic [COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]avian [/FONT][/FONT][FONT=Verdana, Arial, Helvetica, sans-serif][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]influenza[/FONT][/color][/FONT][/color][/color] H5N1 was detected in more than 700 wild birds in the EU in 2006,” the Commission said in a statement.
On Saturday, Nuremberg city authorities posted caution signs around two Bavarian lakes where the wild swans, geese and ducks were found over the past few days. They also set up a four-kilometres exclusion zone around two lakes after the dead birds tested positive for the H5N1 bird flu virus.
Health authorities urged the poultry farmers in the exclusion zone to keep their animals indoors. City officials warned pet owners not to let their dogs or cats roam free in the affected area, called quarantine zone.
Nuremberg is located 120 kilometres from the border with the Czech Republic, where an outbreak of bird flu was reported earlier this month. Czech veterinarians started culling several thousand [COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif][COLOR=blue! important][FONT=Verdana, Arial, Helvetica, sans-serif]turkeys[/FONT][/FONT][/color][/color] at the farm in the village of Tisova in the country's east last week after tests confirmed the country’s first outbreak of a deadly form of bird flu in poultry.
Germany has come under the dark wings of bird flu once again after 2005, when it broke out on the Baltic Sea island of Ruegen and spread to six of the country's 16 states. The strain of extremely infectious H5N1 virus spread to mammals, killing a cat and a stone marten, however, it did not affect humans.
Bird flu in south-east Asia is spreading like wild fire, killing two people in Vietnam this month, bringing the death toll to 43 in the country, since 2003.
So far, Bird flu virus has killed 191 people out of the 313 cases reported, according to the World Health Organization. As of May 31st, 2007, the highest number of cases has been reported in Indonesia, where out of the 98 infected, 78 lost their lives.
Most human infections have occurred after contact with birds infected with H5N1 virus, which according to the Geneva-based WHO is generally not harmful to humans. The H5N1 virus though remains primarily a virus of birds, but experts fright that once it starts transmitting from person to person, it would sweep the world, leaving millions more to die and triggering a devastating human pandemic.
H5N1, also known as A(H5N1), is a subtype of the Influenza A virus that is capable of causing illness in many animal species, including humans, while a bird-adapted strain of H5N1, called HPAI A(H5N1) for "highly pathogenic avian influenza virus of type A of subtype H5N1", is the causative agent of H5N1 flu, commonly known as "avian influenza" or simply "bird flu", and is endemic in many bird populations, especially in Southeast Asia.
Ever since bird flu broke out and started spreading its notorious wings all over the globe, various measures have been taken by all the countries to protect their population.
100% deaths have been reported in Cambodia, Laos and Nigeria. The condition has improved in all the countries ever since the first case was reported in PR China. In 2003, 100% deaths were reported, but the percentage has gradually lowered down to 70%, 43%, 69% and 63% in 2004, 2005, 2006 and 2007 respectively, bringing down the total aggregate to 61%.
WHO, Food and Agriculture Organization (FAO), World Organization for Animal Health (OIE) in collaboration with United States are looking into minimizing the risk of spreading of this disease and taking steps to avoid this to turn into a pandemic on a global level.

http://www.themoneytimes.com/articl...ak_of_h5n1_bird_flu_in_germany-id-105299.html

HenryN · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

translation:

Friedrich Loeffler Friedrich-Loeffler-Institut on the island Riems examines the connection between the cases of bird flu of Boehmen and Nuernberg. "we are about straight to compare the genetic finger mark of the H5N1-Virus from Nuernberg with the H5N1-Virus from Boehmen", said institute president Thomas Mettenleiter on Monday of the press agency of strip packing. The H5N1-Viren found in Nuernberg and Boehmen belongs both to the hochpathogenen variant of the type Asia. "that is, the virus is strong for poultry ill-making and highly aggressively", said Mettenleiter. Within the variant give it "fine subtle differences", therefore a comparison can bring explanation. If the genetic finger marks of the virus from Nuernberg and Boehmen are identical, it does not have to mean however that the birds come from Boehmen. "however it means that there is, said a common source" Mettenleiter. Loeffler Loeffler-Institut had tightened also the bird flu virus H5N1 dangerous for humans on Sunday with six in Nuernberg game birds, five peak swans and a Canada goose, ended. Institut is the only one according to Mettenleiter in Germany, which can confirm the aggressive variant of the H5N1-Virus of the type Asia officially. By the nine suspicion samples from Nuernberg three were not infected with the hochpathogenen H5N1-Virus. Further samples were not announced from Nuernberg.

HenryN · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

SPIEGEL ONLINE - June 25, 2007, 11:45 AM
URL: http://www.spiegel.de/international/germany/0,1518,490500,00.html
IT'S BACK

Germany Reports New Bird Flu Infections

In the first cases to emerge in a year, officials in the Bavarian city of Nuremberg have reported deadly outbreaks of the H5N1 strain of bird flu.

DDP

A firefighter in Nuremberg corrals swans on W?hrder Lake to prevent the spread of the deadly H5N1 virus.

Officials in the southern German city of Nuremberg have reported new outbreaks of avian flu. On Sunday, the city reported having found eight dead swans in addition to a duck and a goose which had fallen victim to the disease. All of the dead waterfowl were confirmed to have been infected with the deadly H5N1 virus in the first cases of the disease to be reported in Germany this year.
A quarantine zone has been established in the city, and poultry farmers have been ordered to place all poultry birds in closed stalls to prevent the disease's spread.
"Over the next few days, the city of Nuremberg will be aided by a federal epidemiological team which will scientifically investigate the causes and background of the infection cases," the city said in a statement, according to Reuters.

BIRD FLU

The Virus
Bird flu, also known as avian influenza, is a highly contagious virus that mostly infects poultry like chickens and turkeys, but it can also be carried by migratory birds, pheasant and guinea fowl. Eighty to 90 percent of the animals that contract the virus die within a few days. In rare cases, humans can also be infected. In Asia, 140 cases have been reported and there have been 74 deaths, according to the World Health Organization. Most of the cases so far have been reported among poultry workers.
Transmission
Bird flu is transmitted from animal to animal through direct contact with feces or saliva and other bodily fluids or through contact with contaminated material, like transport cases or egg cartons. When heavy dust is blown in areas with outbreaks, the contagion can also be transmitted by air.
Symptoms
In most cases, the incubation period between contraction of bird flu and the first symptoms is three to 14 days. Then the general symptoms include high fever, respiratory problems, purple discoloration, loss of appetite, fatigue and diarrhea. But the illness can also lead to sudden death in animals.
Danger for Humans Researchers fear that H5N1 could mutate into a virus that is transmissable between humans. The latest research confirms this fear: Flu subtype H1N1, which was known as the Spanish Flu and killed up to 50 million people between 1918 and 1920, originated as a bird flu that adapted itself to humans. Another concern is that humans could get a double infection of a human flu with a bird flu that could mutate, or that pigs -- which are susceptible to human, bird and swine influenza -- could develop a mutation that leads to an unstoppable super flu that would unleash a global pandemic.

gsgs · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

Nuernberg seem to have announced further samples.
15 in total now. There is also an institute in Oberschleissheim near Munich which can test, but apparantly FLI has to confirm.
I guess they send samples to Oberschleissheim first, but don't
publish their findings directly.

press conference on 17.00 (in 4 hours)

the 5 swans are non-migratory, but the Canada-goose is probably migratory.
It was found on the Silber-lake, which is contaminated with debris and WW2-weapons
and usually no waterfowls are there.

HenryN · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

gsgs said:
Nuernberg seem to have announced further samples.
15 in total now. There is also an institute in Oberschleissheim near Munich which can test, but apparantly FLI has to confirm.
I guess they send samples to Oberschleissheim first, but don't
publish their findings directly.

press conference on 17.00 (in 4 hours)

So is the official count 6 positives (including 1 Canada goose), 3 negatives, and 6 being tested?

I assume all 15 are from dead wild waterfowl?

HenryN · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

LOCUS AM403474 1707 bp RNA linear VRL 31-MAR-2007
DEFINITION Influenza A virus (A/Canada goose/Germany/R1207/06(H5N1)) HA gene
for hemagglutinin, genomic RNA.
ACCESSION AM403474
VERSION AM403474.1 GI:136054858
KEYWORDS HA gene; hemagglutinin.
SOURCE Influenza A virus (A/Canada goose/Germany/R1207/06(H5N1))
ORGANISM Influenza A virus (A/Canada goose/Germany/R1207/06(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1
AUTHORS Starick,E., Werner,O., Harder,T., Globig,A., Hoffmann,B. and
Beer,M.
TITLE Sequence analysis of HA and NA genes of H5N1 HPAIV isolates from
Germany clearly identifies two clusters
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1707)
AUTHORS Starick,E.
TITLE Direct Submission
JOURNAL Submitted (25-SEP-2006) Starick E., Fed. Res. Inst. for Animal
Health, Fr.-Loeffler-Institut, Boddenblick 5a, 17493
Greifswald-Insel Riems, GERMANY
FEATURES Location/Qualifiers
source 1..1707
/organism="Influenza A virus (A/Canada
goose/Germany/R1207/06(H5N1))"
/virion
/mol_type="genomic RNA"
/strain="A/Canada goose/Germany/R1207/06"
/serotype="H5N1"
/db_xref="taxon:404925"
/country="Germany"
gene 1..1707
/gene="HA"
CDS 1..1707
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="CAL48265.1"
/db_xref="GI:136054859"
/translation="MEKIVLLFAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFLNVPEWSYIVEKINPA
NDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKNSWSDHEASSGVSSACPYQGRSSFF
RNVVWLIKKDNAYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNPTTYISVGT
STLNQRLVPKIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPENAYKIVKKG
DSTIMKSELEYGNCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLR
NSPQGERRRKKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAID
GVTNKVNSIINKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMEN
ERTLDLHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHRCDNECMESVRNGTYDYPQY
SEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRI
CI"
ORIGIN
1 atggagaaaa tagtgcttct ttttgcaata gtcagtcttg ttaaaagtga tcagatttgc
61 attggttacc atgcaaacaa ctcgacagag caggttgaca caataatgga aaagaacgtc
121 actgttacac acgcccaaga catactggaa aagacacaca acgggaagct ctgcgatcta
181 gatggagtga agcctctaat tttaagagat tgtagtgtag ctggatggct cctcgggaac
241 ccaatgtgtg acgaattcct caatgtgccg gaatggtctt acatagtgga gaagatcaat
301 ccagccaatg acctctgtta cccagggaat ttcaacgact atgaagaact gaaacaccta
361 ttgagcagaa taaaccattt tgagaaaatt cagatcatcc ccaaaaattc ttggtcagat
421 catgaagcct catcaggggt gagctcagca tgtccatacc agggaaggtc ctcctttttt
481 agaaatgtgg tatggcttat caaaaaggac aatgcatacc caacaataaa gagaagttac
541 aataatacca accaagaaga tcttttggta ctgtggggga ttcaccatcc aaatgatgcg
601 gcagagcaga caaggctcta tcaaaaccca accacctata tttccgttgg gacatcaaca
661 ctaaaccaga gattggtacc aaaaatagct actagatcca aggtaaacgg gcaaagtgga
721 aggatggagt tcttttggac aattttaaaa ccgaatgatg caataaactt tgagagtaat
781 ggaaatttca ttgctccaga aaatgcatac aaaattgtca agaaagggga ctcaacaatt
841 atgaaaagtg aattggaata tggtaactgc aacaccaagt gtcaaactcc aataggggcg
901 ataaactcta gtatgccatt ccacaacatc caccctctca ccatcgggga atgccccaaa
961 tatgtgaaat caaacagatt agtccttgcg actgggctca gaaatagccc tcaaggagag
1021 agaagaagaa aaaagagagg actatttgga gctatagcag gttttataga gggaggatgg
1081 cagggaatgg tagatggttg gtatgggtac caccatagca acgagcaggg gagtgggtac
1141 gctgcagaca aagaatccac tcaaaaggca atagatggag tcaccaataa ggtcaactcg
1201 atcattaaca aaatgaacac tcagtttgag gccgttggaa gggaatttaa taacttagaa
1261 aggagaatag aaaatttaaa caagaagatg gaagacggat tcctagatgt ctggacttat
1321 aatgctgaac ttctggttct catggaaaat gagagaactc tagaccttca tgactcaaat
1381 gtcaagaacc tttacgacaa ggtccgacta cagcttaggg ataatgcaaa ggagcttggt
1441 aacggttgtt tcgagttcta tcacagatgt gataatgaat gcatggaaag tgtaagaaac
1501 ggaacgtatg actacccgca gtattcagaa gaagcaagat taaaaagaga ggaaataagt
1561 ggagtaaaat tggaatcaat aggaacctac caaatactgt caatttattc aacagtggcg
1621 agctccctag cactggcaat catggtggct ggtctatctt tatggatgtg ctccaatgga
1681 tcgttacaat gcagaatttg catttaa

HenryN · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

LOCUS EF165057 1707 bp cRNA linear VRL 16-DEC-2006
DEFINITION Influenza A virus (A/buzzard/Bavaria/13/2006(H5N1)) hemagglutinin
(HA) gene, complete cds.
ACCESSION EF165057
VERSION EF165057.1 GI:119352131
KEYWORDS .
SOURCE Influenza A virus (A/buzzard/Bavaria/13/2006(H5N1))
ORGANISM Influenza A virus (A/buzzard/Bavaria/13/2006(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1707)
AUTHORS Rinder,M., Lang,V., Fuchs,C., Hafner-Marx,A., Bogner,K.-H.,
Neubauer,A., Buettner,M. and Rinder,H.
TITLE Genetic evidence for multi-event imports of avian influenza virus A
(H5N1) into Bavaria, Germany
JOURNAL J. Vet. Diagn. Invest. (2007) In press
REFERENCE 2 (bases 1 to 1707)
AUTHORS Rinder,M., Lang,V., Buettner,M. and Rinder,H.
TITLE Direct Submission
JOURNAL Submitted (06-DEC-2006) S10 Veterinaervirologie, Bayerisches
Landesamt fuer Gesundheit und Lebensmittelsicherheit,
Veterinaerstr. 2, Oberschleissheim 85764, Germany
FEATURES Location/Qualifiers
source 1..1707
/organism="Influenza A virus
(A/buzzard/Bavaria/13/2006(H5N1))"
/mol_type="viral cRNA"
/strain="A/buzzard/Bavaria/13/2006"
/serotype="H5N1"
/db_xref="taxon:415684"
/country="Germany"
gene 1..1707
/gene="HA"
CDS 1..1707
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="ABL63763.1"
/db_xref="GI:119352132"
/translation="MEKIMLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFLNVPEWSYIVEKINPA
NDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKSSWSDHEASSGVSSACPYQGRSSFF
RNVVWLIKKDNAYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNPTTYISVGT
STLNQRLVPKIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPENAYKIVKKG
DSTIMKSELEYGNCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLR
NSPQGERRRKKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAID
GVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMEN
ERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHRCDNECMESVRNGTYDYPQY
SEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRI
CI"
ORIGIN
1 atggagaaaa taatgcttct tcttgcaata gtcagtcttg ttaaaagtga tcagatttgc
61 attggttacc atgcaaacaa ctcgacagag caggttgaca caataatgga aaagaacgtc
121 actgttacac acgcccaaga catactggaa aagacacaca acgggaaact ctgcgatcta
181 gatggagtga agcctctaat tttaagagat tgtagtgtag ctggatggct cctcgggaac
241 ccaatgtgtg acgaattcct caatgtaccg gaatggtctt acatagtgga gaagatcaat
301 ccagccaatg acctctgtta cccagggaat ttcaacgact atgaagaact gaaacaccta
361 ttgagcagaa taaaccattt tgagaaaatt cagatcatcc ccaaaagttc ttggtcagat
421 catgaagcct catcaggggt gagctcagca tgtccatacc agggaaggtc ctcctttttt
481 agaaatgtgg tatggcttat caaaaaggac aatgcatacc caacaataaa gagaagttac
541 aataatacca accaagaaga tcttttggta ctgtggggga ttcaccatcc aaatgatgcg
601 gcagagcaga caaggctcta tcaaaaccca accacctata tttccgttgg gacatcaaca
661 ttaaaccaga gattggtacc aaaaatagct actagatcca aggtaaacgg gcaaagtgga
721 aggatggagt tcttttggac aattttaaaa ccgaatgatg caataaactt tgagagtaat
781 ggaaatttca ttgctccaga aaatgcatac aaaattgtca agaaagggga ctcaacaatt
841 atgaaaagtg aattggaata tggtaactgc aacaccaagt gtcaaactcc aataggggcg
901 ataaactcta gtatgccatt ccacaacatc caccctctca ccatcgggga atgccccaaa
961 tatgtgaaat caaacagatt agttcttgcg actgggctca gaaatagccc tcaaggagag
1021 agaagaagaa aaaagagagg actatttgga gctatagcag gttttataga gggaggatgg
1081 cagggaatgg tagatggttg gtatgggtac caccatagca acgagcaggg gagtgggtac
1141 gctgcagata aagaatccac tcaaaaggca atagatggag tcaccaataa ggtcaactcg
1201 atcattgaca aaatgaacac tcagtttgag gctgttggaa gggaatttaa taacttagaa
1261 aggagaatag aaaatttaaa caagaagatg gaagacggat tcctagatgt ctggacttat
1321 aatgctgaac ttctggttct catggaaaat gagagaactc tagactttca tgattcaaat
1381 gtcaagaacc tttacgacaa ggtccgacta cagcttaggg ataatgcaaa ggagcttggt
1441 aacggttgtt ttgagttcta tcacagatgt gataatgaat gtatggaaag tgtaagaaac
1501 ggaacgtatg actacccgca gtattcagaa gaagcaagat taaaaagaga ggaaataagt
1561 ggagtaaaat tggaatcaat aggaacttac caaatactgt caatttattc aacagtggcg
1621 agctccctag cactggcaat catggtggct ggtctatctt tatggatgtg ctccaatgga
1681 tcgttacaat gcagaatttg catttaa

HenryN · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

gsgs said:
Nuernberg seem to have announced further samples.
15 in total now. There is also an institute in Oberschleissheim near Munich which can test, but apparantly FLI has to confirm.
I guess they send samples to Oberschleissheim first, but don't
publish their findings directly.

press conference on 17.00 (in 4 hours)

the 5 swans are non-migratory, but the Canada-goose is probably migratory.
It was found on the Silber-lake, which is contaminated with debris and WW2-weapons
and usually no waterfowls are there.

Both labs have done sequencing on H5N1 samples collected last year. The group just north of Munich published sequences with "Bavaria" as the location. FLI used Germany. The sequences from both groups fell into three groups, but there were more samples from FLI from the north. The outbreak in the north was the largest in western Europe and generated many positives (mostly in mute swans but also included a cat and a stone martin).

The sequences most like the public Czech Republic sequence were in the south and also were close to isolates from Italy, Slovenia, and Ukraine. Because of detection in the Czech Republic and Bavaria at the same time, the two sets of sequences may be similar, but as noted above, the similarity would indicate a common source, not infection of domestic turkeys by wild birds from Bavaria. This year the H5N1 is likely to be more complex and diverse than last year (this isn't Kansas).

gsgs · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

maybe both are similar to the Hungarian sequences...

they wrote, that they developed a method to test multiple HA-sequences easily
and simultaneously at Oberschleissheim,
but apparantly they can't do full genomes easily.
So, that could be the reason that the samples were sent to Riems.
Hopefully we will see full genomes.

HenryN · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

gsgs said:
maybe both are similar to the Hungarian sequences...

There are many German markers that are not in the isolates from Hungary.

I expect the German and Czech isolates to have significant similarities to last year's isoaltes from Germany.

H5N1 is endemic to the region. Mute swans don't migrate, and even migratory birds don't migrate in the heart of western Europe in the summer.

HenryN · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

Six German birds have bird flu

Mon, Jun 25, 2007
Six dead wild birds have tested positive in Germany for a lethal strain of bird flu, but authorities said today they did not expect the disease to spread outside the southern region where it was discovered over the weekend.
Yesterday, three wild birds found dead in Nuremberg in the southern state of Bavaria tested positive for the deadly H5N1 strain of the disease. The number of cases has since risen to six, with five swans and one goose infected, the Friedrich Loeffler Institute, a veterinary institution, said.
Authorities continued to investigate the outbreak, the first in Germany this year, which was discovered as part of a national testing programme for dead birds.
The government did not expect the outbreak to spread to other regions of the country, a spokeswoman for the Agriculture Ministry said.
Investigations were focusing on how the disease entered Germany. It was possible it spread from the Czech Republic, where an outbreak was reported recently, the spokeswoman said.
"But this is only conjecture," she said.
Poultry farmers in the Nuremberg region have been ordered to confine all poultry to closed stalls. As of Saturday, a 21-day ban was imposed on moving poultry or poultry products in or out of the area, which is now a quarantine zone.
City officials also warned cat and dog owners not to allow their pets to roam freely in the quarantine zone. Last year, some 13 European Union member states had confirmed cases of bird flu -- Germany, Austria, Denmark, Italy, Greece, Britain, the Czech Republic, Poland, Slovakia, Slovenia, Sweden, France and Hungary.
Bird flu has been spreading across southeast Asia, killing two people in Vietnam this month, the first deaths there since 2005. Globally, the H5N1 virus has killed nearly 200 people out of over 300 known cases, according to the World Health Organisation. None of the victims were from Europe.

http://www.ireland.com/newspaper/breaking/2007/0625/breaking37_pf.html

unpathedhaunt · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

niman said:
Six German birds have bird flu

Mon, Jun 25, 2007
Six dead wild birds have tested positive in Germany for a lethal strain of bird flu, but authorities said today they did not expect the disease to spread outside the southern region where it was discovered over the weekend.
Yesterday, three wild birds found dead in Nuremberg in the southern state of Bavaria tested positive for the deadly H5N1 strain of the disease. The number of cases has since risen to six, with five swans and one goose infected, the Friedrich Loeffler Institute, a veterinary institution, said.
Authorities continued to investigate the outbreak, the first in Germany this year, which was discovered as part of a national testing programme for dead birds.
The government did not expect the outbreak to spread to other regions of the country, a spokeswoman for the Agriculture Ministry said.
Investigations were focusing on how the disease entered Germany. It was possible it spread from the Czech Republic, where an outbreak was reported recently, the spokeswoman said.
"But this is only conjecture," she said.
Poultry farmers in the Nuremberg region have been ordered to confine all poultry to closed stalls. As of Saturday, a 21-day ban was imposed on moving poultry or poultry products in or out of the area, which is now a quarantine zone.
City officials also warned cat and dog owners not to allow their pets to roam freely in the quarantine zone. Last year, some 13 European Union member states had confirmed cases of bird flu -- Germany, Austria, Denmark, Italy, Greece, Britain, the Czech Republic, Poland, Slovakia, Slovenia, Sweden, France and Hungary.
Bird flu has been spreading across southeast Asia, killing two people in Vietnam this month, the first deaths there since 2005. Globally, the H5N1 virus has killed nearly 200 people out of over 300 known cases, according to the World Health Organisation. None of the victims were from Europe.

http://www.ireland.com/newspaper/breaking/2007/0625/breaking37_pf.html

Well, of course it won't spread. Dead birds don't fly. Next we will hear that it's been eradicated. Enough!

HenryN · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

Brussels, 24 June 2007

Avian influenza H5N1 confirmed in wild swans in Germany: authorities applying precautionary measures

The German authorities have informed the European Commission that laboratory tests carried out at the regional laboratory in Bavaria and the national reference laboratory for avian influenza in Insel Riems have detected the presence of the highly pathogenic avian influenza virus H5N1 in two swans found dead in the province of N?rnberg, in Bavaria.

The German authorities are applying the precautionary measures set out in Commission Decision 2006/563/EC on certain protection measures in relation to highly pathogenic avian influenza in wild birds in the Community. The Decision sets out the measures to be applied in any EU Member State which has a case of suspected or confirmed highly pathogenic avian influenza H5N1 virus in wild birds.
The measures consist of the establishment of a control area and a surrounding monitoring area around the positive finding. This zoning is taking into the geographical, ecological and epidemiological factors of the concerned area. In the control area, on-farm biosecurity measures must be strengthened, hunting of wild birds is banned, disease awareness of poultry owners must be enhanced, movement of poultry is banned except directly to the slaughterhouse and the dispatch of meat outside the zone is forbidden except where products have undergone the controls provided for in EU food controls legislation. These measures are aimed at preventing the spread of avian influenza from wild birds to poultry or other captive birds, as well as the contamination of products. However, Community legislation foresees the possibility to adapt the above measures to the local situation and grant derogations based on a risk assessment.
Highly pathogenic avian influenza H5N1 was detected in more than 700 wild birds in the EU in 2006. However, the two infected swans in Bavaria are the first cases reported in wild birds in 2007.
This year, avian influenza H5N1 has been confirmed in poultry farms in 3 Member States: Hungary and United Kingdom (in a total of three farms, in late January/early February) and in the Czech Republic, in one farm, only two days ago. Only geese and turkeys have been affected.

http://www.europa.eu/rapid/pressRel...format=HTML&aged=0&language=EN&guiLanguage=en

HenryN · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

BIRD FLU: GERMAN AUTHORITIES CONFIRM H5N1 VIRUS IN WILD BIRDS

Hamburg and Brussels, 25 June (AKI) - A total six wild birds found dead in southern Germany have tested positive for the dangerous H5N1 strain of bird flu, the German authorities said on Monday. Under European Union rules, a buffer zone is being set up in the province of Nuremberg in the southern state of Bavaria, a ban of hunting of wild birds, movement of poultry other than to the slaughterhouse. Only meat that has undergone EU specified food controls may be moved outside the buffer zone, the European Commission said on Monday in a statement.

"These measures are aimed at preventing the spread of avian influenza from wild birds to poultry or other captive birds, as well as the contamination of products," the Commission stated.

Three wild birds found dead in Nuremburg were found to have the highly pathogenic H5N1 strain of bird blu. The members of cases as now rise to six, with five swans and one goose infected, according to the Friedrich Loeffler veterinary institute. It is the first outbreak of bird flu in Germany in 2007. The cases are also the first to be reported in wild birds in the EU this year.

H5N1 was confirmed in February 2006 in some 100 wild swans on the Baltic Sea island of Ruegen in northern Germany, as well as in a dead cat, prompting the local authorities to declare a state of emergency. The virus was last year identified in dead migratory birds in the southern states of Bavaria and Baden-Wuerttemberg, and the northern regions of Mecklenburg-Western Pomerania, Schleswig-Holstein and Brandenburg.

H5N1 was detected in more than 700 wild birds in the EU in 2006. H5N1 has been confirmed this year in geese and turkey farms in Hungary, the United Kingdom and in the Czech Republic.

The H5N1 virus has killed nearly 200 people worldwide out of more than 300 known cases, according to the UN World Heath Organisation (WHO). The great majority of victims have been from southeast Asia, where the disease was first reported in 2003.

(Ajd/Aki)

http://www.adnki.com/index_2Level_English.php?cat=Security&loid=8.0.428886682&par=0#

HenryN · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

Commentary at

http://www.recombinomics.com/News/06250701/H5N1_WB_Victims.html

gsgs · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

> The H5N1 went from Qinghai Lake in China to Erhel Lake in Mongolia
> and Chany Lake in Russia.

almost all Qinghai sequences have 4 characteristic markers in PB2
(and I think some others in other segments)
which don't appear elsewhere.

That makes it doubtful IMO that any of the H5N1 viruses from
Qinghai-lake survived.

HenryN · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

gsgs said:
> The H5N1 went from Qinghai Lake in China to Erhel Lake in Mongolia
> and Chany Lake in Russia.

almost all Qinghai sequences have 4 characteristic markers in PB2
(and I think some others in other segments)
which don't appear elsewhere.

That makes it doubtful IMO that any of the H5N1 viruses from
Qinghai-lake survived.

Most of the Qinghai Lake sequences at Genbank were from early isolates. Later isolates were published at Los Alamos. Birds at Qinghai Lake come from multiple overlapping flyways, including those that are east of Qinghai Lake. Few Qinghai sequences from China have been published. No Qinghai sequences form South Korea or Japan have been published. Only partial Qinghai sequences from India have been published.

H5N1 doesn't read Genbank sequences, which are far from representative of the full complement of Qinghai sequences that emgerged from Qinghai infections.

Thus, your conclusions about what emerged from Qinghai Lake have no scientific basis.

gsgs · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

lanl sequences are included as well.
About 31 full genomes, all except one
(A/bar-headed Gs/Qinghai/2/2005) have the markers.

That last one is not really Qinghai, but similar to pre-Qinghai strains
before the reassortment which created the Qinghai strain.

HenryN · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

gsgs said:
lanl sequences are included as well.
About 31 full genomes, all except one
(A/bar-headed Gs/Qinghai/2/2005) have the markers.

That last one is not really Qinghai, but similar to pre-Qinghai strains
before the reassortment which created the Qinghai strain.

How many Qinghai sequences from China, India, Japan, or South Korea?

gsgs · Jun 25, 2007

Re: Deadly bird flu strain found in Germany

other sequences usually don't have the markers either, I think.
(Vietnam,Indonesia,Korea/2004,..)
PB2:C222A,G361A,A362G,G564A

Code:

                                                000000000000000000000000000011111111111111111111111111111111111111111111111112222222222222 0000000000000000000000000000000001111111111111111111111111111111111111111111111111111111111111112222222222222 0000000000000000000000000000000000000000011111111111111111111111111111111111111111111111111111111111222 000000000000000000000000011111111111111111111 0000000000000000000000000000000000000111111111111111 0000000000000011111111111 00000000000000000001 0000000000000000000000000000000 
                                                000122333344445556778888899900011111122223333455555666777778888888999999999990000001111123 0011222444555666667788888999999990000011111111222222223333333334444444444555556677788888888888880000000223333 0011222223334444555556667788888888899999900011111111122222233344444555556666667777778888888888999999011 011222234455555667777888900011223344555566777 1122233333333444455566666666666778899000001122222235 1122333677788911111223344 22345555777778888990 1222233333344444555666666667788 
                                                456026666878893685082458869900201247713380569600358169123451136689222346689991334472246923 5844348258248336891302567333668892346803677799013589990111222590223455677012244414803334466667791234677570013 2416445780173389034497999911355778914578924901234588933359925704478346793666660488990123457899146689947 648359957713667773559159837829582299125907667 5728945555569145701501122346669190366344484856888944 4519034217844100136365956 04447888345894559135 0023401456844559047022455881928 
                                                871827129772521484268985604625499886933615957206077152984323553473489415720289076960423645 9206501225451258667274813039034899242304634639924416795279369924087026905611757840840355803890899516736062906 9278098680522592110620692846728690725524001848666525901373660410165063830245677025029573818869492513280 135610623486470078181886681576692839422619458 7785082457963419473335814623596727406846709036157348 7924916417727635132784391 89621039984430082068 1124918247478698140635938248911 
-codon-position---------------------------------  1   12   22           1 1   12  2  1      21             1 2 1  12 2  221   2    2    11 21221 22222222222    2         1      2 2 1 22  1   1  1 2      1    12 2 2    11  1  2    2 1          212 2 2                   11    1      1   1       212    2 1         1   1   1 2 12    21       1   2  111 1 122222212 22   12 1222 22  222222222211 22 12 1   2 1 1 2        1        2          2   12  1       2  11   12112112112111  1 11111111111 1 11 2 2    1   1  1    1  211211 1122 
---Index----------------------------------------GGTAAGGATCTCATCGATGCTGGGCACGTTGGGGAATAGAACTGCAAATTTGCCGAGAGGTGACGAAAGGGGGGAACCCATTGGGGAAGG TTGGAATGAAGGGAGGAGTTTGATGTACTTTAGGAGCAGGATCTTATAGCCTCGCTCTAGACCGCAATTTACGGTGTTAAAGAGATTCACTTCTATCAGTCGTGAACAG TTGTCGAAGTTAGGGGAGATCAGCGTTGCGTACCCCAGGGGGCCAAAGCCGCGAGATCGGTTCCCTTTACTTTCTCGATCAATCAAAAGGCAGCAGGGTTTGG AGCTAGATAGGTAAGGTAGGTAATCGGAGCGCAATCCGGTACATA ACTGGTAGAGAGCGGCAGGTAGAGAGTCACGTGTTTAGATAGGGAAAATCAG AACCCTATTAAGTTGCCTTACGTTC TAGTAAGGGGACGATGGGGA TAGAGCCCCACTGAGACACATAAAGGTAGCA 
  1 >A/bar-headed Gs/Qinghai/2/2005             ------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------- .......C.......A..................G.........C G.........G............AG..T.TA.A.AC.A...A.A..C.G... .G.....C.......T.G....G-- -------------------- -------------------------------      833    379 ,     35     24      1:>A/bar-headed Gs/Qinghai/2/2005             
  2 >A/migratory Dk/Jiangxi/2300/2005           ------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------- ..........................................--- G.........G...................A...............C..... .......C......AT.......-- -------------------- -------------------------------      815    365 ,     11      7      2:>A/migratory Dk/Jiangxi/2300/2005           
  3 >A/Ck/ST/4231/2003                          ------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------- ..T....CC..CG.A....AC.T.A.A...............--- G........AG....T.........A....A.......TGG----------- .....C.C.......T......G-- -------------------- -------------------------------      894    393 ,     52     24      3:>A/Ck/ST/4231/2003                          
  4 >A/bar-headed Gs/Qinghai/9/2005             ......A.C.G.........C.ACT...C.........AGG..A....GC........AAGATAAC.C.A..AAGG...GCCA..A...- ..AA.....G.AA......CC..............ATGA..CTG...................A....C...C.GA..GGCAG..CC..TGCTG..............- -......GAA..AA...ACCT..TA...........G.A.....G.G.......AGCTAA.C..T.C.C....TCTCGG...CTG.G.AA..ATG.TACC..A ......T..A.C...A.G.A.C..A........GG...ACC.... ..G.A........A...........A......A.ACTA...AAA..CGG..A ..T.......C.C..T.......-- .G.C.G.A.TGTA..AA.-- ............................---      225    162 ,    173    152      4:>A/bar-headed Gs/Qinghai/9/2005             
  5 >A/bar-headed Gs/Qinghai/10/2005            ..........GT.G..G.....C..G..C....A...GAG.........C........A..A..AC.CAA..AA.GT..GCC....C.A- ..AAG......A...AG...C.CCA........AT.TGA..CTGCGCG..TCTAT...G.G.AAGGGCC...C.GA...GCAG..CC..TGCTG.C.GA..C......- -.....G...C.AA..CACCT.....C...CGT..........................A.....CC.......CTCG....CT....AA..A.G.TA.CCAA ....CAT..A.C...A...AC.............G..AAC...G. .TG.ACCAGAGA..A.C.A.GAC.GA.T....A.ACTA..GA.A..CGG..A ......G.....C..T.......-- .G.C.G.A.TGT..C..A-- ..........T.A.A.AGG.........---      259    186 ,    207    176      5:>A/bar-headed Gs/Qinghai/10/2005            
  6 >A/great black-headed gull/Qinghai/3/2005   ..............T.....C....G..CC........................A......A.......A..AA...............- ..AAC...............C.CCAAGTCCCCAA.......CTGCGC.......T........A...CC...CAGA.CGGCCG..CC.GTGCTG...GA..C......- -........AC.AAA..ACCT...............G...A...G.GATT....A.C.AA.C.T..C......TCTCGGT..C.G...AA..ATG.TA....A ..T.C.T..ATC...A.G.ACCT..AA..T....G..AACC.... .TG.ACCAGAGA....C.A.GAC.GA......A.A.TA.....A..CGG.GA GG........C....T.......-- .G.......T.T.GCA..-- ...G..T......GA..G.........G---      239    170 ,    187    160      6:>A/great black-headed gull/Qinghai/3/2005   
  7 >A/great black-headed gull/Qinghai/2/2005   ..........G.........C.ACT...CC.A.AG..GAG.........C....A......A..A...A...AA.G.........A..A- .....C..G..AA.A....CC.CCA.............A..CTGCGC...T...T...G.G......C.A..CAGACCGGCCG..CC.G.GCTG...GA..C......- -........A...AA.CACC..T.A...........G......TGG.ATT....A.C.AA.C.T.CC...C..TCTCGG......G..AA..A...T.C..AA .....AT..AT....A...A.CT..A......G.G..A...T... ...................................................- G.....G...C.C..T.......-- .........T.T.GCA..-- ...............G..............-      202    139 ,    153    130      7:>A/great black-headed gull/Qinghai/2/2005   
  8 >A/bar-headed Gs/Qinghai/8/2005             ......A.C...........C.A.....C....A...GAG........GC.........AG.TAA........A............C..- ..AA.......AA.A.........A..........A..A.GCTGCGC..T....T.......AAGGGCCCCTCAGA....CA........GCTG.A..A..C......- -......G.AC..A..CACCT.T..CC...C.......A.AA...G.........GC.AA.C.TT........TCTCGG...C.GGG.AA......TACC.AA ....C.T..A.C...A.G.A............GG.T..A...... .............A...................................... ..T..CG...C.C..T.......-- .G.......T.T....A.-- .TT.A.....T.A.A......C.....G---      198    140 ,    146    130      8:>A/bar-headed Gs/Qinghai/8/2005             
  9 >A/bar-headed Gs/Qinghai/5/2005             ......A.............C....GT.C........GA....A.....C.........A..T.A..C.......G.....CA..AC..- ............................................................................................................- -......G..CG.AA.CACCT.T.A...........G.A.AA.T.GGAT.....A...A.....TCC.C....TCTCGGT.....GGGAA..AT..T.C..AA ...........................................G- .................................................... .......................-- .................... ...............G..............C      108     72 ,     70     66      9:>A/bar-headed Gs/Qinghai/5/2005             
 10 >A/bar-headed Gs/Qinghai/65/2005            ...................................................A...................................... ............................................................................................................A -.......................................A.............................................................. ..........................................--- .................................................... .......................-- .................... ...............G..............-       45     11 ,      9      4     10:>A/bar-headed Gs/Qinghai/65/2005            
 11 >A/bar-headed Gs/Qinghai/68/2005            ...................T.....................................................................- .............................Y..............................................................T...............- -............................A.......A................................................................. ..........................................--- .................................................... .......................-- .................... ...............G......T.......-       48     16 ,      8      7     11:>A/bar-headed Gs/Qinghai/68/2005            
 12 >A/bar-headed Gs/Qinghai/0510/2005          ...................T.....................................................................- .............................Y..............................................................T...............- -............................A.......A................................................................. G.........................................--- .................................................... .......................-- .................... ...............G......T.......-       61     17 ,     17      8     12:>A/bar-headed Gs/Qinghai/0510/2005          
 13 >A/bar-headed Gs/Qinghai/60/2005            ......................................................................A..................- ............................................................................................................- --......................................A.............................................................. .........................A................--- .................................................... .......................CT .................... ..............................C       45     13 ,     19      6     13:>A/bar-headed Gs/Qinghai/60/2005            
 14 >A/brown-headed Gull/Qinghai/3/2005         .............................................G.....................................A.....- .............................C..............................................................................- -...................................................................................................... .........................A....A...........--- ...................................................- .......................-- .................... ..............................-       47     15 ,      5      5     14:>A/brown-headed Gull/Qinghai/3/2005         
 15 >A/bar-headed Gs/Qinghai/67/2005            .........................................................................................- ............................................................................................................- -.....................................A................................................................ .........................A................--- .................................................... .......................-- .................... ..............................-       43     11 ,      3      2     15:>A/bar-headed Gs/Qinghai/67/2005            
 16 >A/Dk/Novosibirsk/02/2005                   ....C.AG.......A.............................C....................G......................T ..........A.................................................................................................. C...................................................................................................C.. ..............A................T............. ..........G...................A....................- ...............T.......CT .................... C.............................-       62     20 ,     46     18     16:>A/Dk/Novosibirsk/02/2005                   
 17 >A/Ck/Inner Mongolia/64/2005                ....C.AG.......A..............C..........................................................- ..A.......A......A...............................................G..........................................- -......................T................AA.....A....................................................C.. G..................A...C.......T............. ..........G......................................... .............C.T.......-- ..................-- C...A...................A...---      102     34 ,     50     24     17:>A/Ck/Inner Mongolia/64/2005                
 18 >A/grebe/Novosibirsk/29/2005                ....C.AGC......A...................................AT........................T............ ..........A............................................................................................A..... ...................................T.......................................................G........C.. ............................................. ..........G...................A..................... ........................- .................... C..............................       60     17 ,     44     16     18:>A/grebe/Novosibirsk/29/2005                
 19 >A/swan/Germany/R65/2006                    ....C.AG.T.....A..A.........C.............................T............................... ..........A.............A.................................................................................... ....T............A..................................................................................C.. ............G..............................C. ..........G....T..............A..................... ......................... .................... C............G.................       61     20 ,     61     20     19:>A/swan/Germany/R65/2006                    
 20 >A/bar-headed Gs/Qinghai/75/2005            .........................................................................................- .......................................................................................................------ -...................................................................................................... ..........................................--- .................................................... .......................-- .................... ...............G..............-       50     15 ,      1      1     20:>A/bar-headed Gs/Qinghai/75/2005            
 21 >A/bar-headed Gs/Qinghai/59/2005            .........................................................................................T ...........................................................................................................C- -...................................................................................................... ..........................................T-- .................................................... .......................-- .................... ...............G..............C       44     11 ,     10      5     21:>A/bar-headed Gs/Qinghai/59/2005            
 22 >A/Environment/Qinghai/31/2005              ---......................................................................................- .......................................................C...................---------------------------------- -...................................................................................................... .........................A................--- ...................................................- .......................-- ...........T........ ..............................-      121     49 ,      4      3     22:>A/Environment/Qinghai/31/2005              
 23 >A/black-headed Gs/Qinghai/2/2005           ---.C...........G........................................................................- -......................................................C----------------------------------------------------- --....................................................................................................- -........................A...............T--- ...................................................- .....................---- ...................G -...........................AT-      195     80 ,     11      8     23:>A/black-headed Gs/Qinghai/2/2005           
 24 >A/great black-headed gull/Qinghai/1/2005   ---....................................................................................G.- -..............................................G.......C----------------------------------------------------- --...........................................................CT..C.A..................................- ..................A......A...T....G......T... ....................G..A....C...A......GG........... ......G....AC..T.......-- ..................-- ...G........................---      201     91 ,     38     23     24:>A/great black-headed gull/Qinghai/1/2005   
 25 >A/bar-headed Gs/Qinghai/1/2005             A....A......C.......C.A.....C..A.....GA...CA.....CC......................................- .C.........A....G........................CTA..CGA.......TC.AGA.A...C..CTC.GA.C...A.A.....T.CTGGC..A..CC.....- -..............A..........................................................................A............ ....C..C.......A...A.....AA.......G.........C .T...C........A.........G.AT.T...........A.A....GT.A ............C..T.G.....-- .G.......T.......A-- ..............A..........A.G---      136     87 ,     84     77     25:>A/bar-headed Gs/Qinghai/1/2005             
 26 >A/whooper swan/Qinghai/1/2005              A....A......C.......C.A.....C..A.....GA...CA.....CC......................................- .C.........A....G........................CTA..CGA.......TC.AGA.A...C..CTC.GA.C...A.A.....T.CTGGC..A..CC.....- -..............A..........................................................................A............ .A....T............AA....A..A.S.....T..C..T.. .T...C........A.........G.AT.T...........A.A....GT.A GG.A.......A...T...G...-- ..................-- ..............A..........A.G---      135     89 ,     83     79     26:>A/whooper swan/Qinghai/1/2005              
 27 >A/brown-headed gull/Qinghai/1/2005         ..C.................C....GT.C..A.....GAG...................A....................C.A.....A- .CA.C..A.G.AAGA.....C.CCA.G.C..CA....CA..CTGCGC................A.....C.....................CTG....A..C......- -.....T.......A.CAC..C...CCTT................G.A...TCCAG..A.CCTTT.C......TCTCGG...C.....AA..A.GCTACC..A ....C.....TC...A...A.C....A......G......C...C .TG........A..A.C.AAG.C.G...CT...................... G......................-- ..................-- ...............G......T....G---      172    122 ,    120    112     27:>A/brown-headed gull/Qinghai/1/2005         
 28 >A/bar-headed Gs/Qinghai/4/2005             ..........G......G..C.A.....C....AG..GAG...A.....C.........A..T.A..........G...G.CA...C..- ..A.CC.....AA.A....CC............A.A.GA.GCTGCGCG.T.CTAT.T...G..A.....C.T...A....C..........CTG.......A...G..- C.....T.......A.CAC..C...CCTT................G.A...TCCAG..A.CCTTT.C......TCTCGG...C.....AA..A.GCTACC..A ....C.T..............C............GT.AS....G. .TG..CCAGA.A....CT..G.C.GA.T.........A.....A..C.G.G. ..........C.C..T.......-- .GT.GG...T.....AA.-- ..T.......T.ATA............G---      220    152 ,    172    143     28:>A/bar-headed Gs/Qinghai/4/2005             
 29 >A/bar-headed Gs/Qinghai/3/2005             ..........G..GT..G..C....GT.C....A...GAG..CA.....C.........A.......C.......G......A..AC.A- .......AG..AA.......C.CCACG.CCCCA.T...A..CTGCGCG......T........A...C....C.GACC.......C...TCCTG...GA..C......- -..........G...................GTT......................C..A.............TCTCG........................A ........CATC...A...A.C...AA.A....G..T..C..... ..................A.G..AGA.T.T.....CTA....AA...CG.GA ............C.........G-- .GT......CGT......-- ............................---      187    121 ,    135    111     29:>A/bar-headed Gs/Qinghai/3/2005             
 30 >A/great cormorant/Qinghai/3/2005           .................G..C.A..GT.C..A.AG..GAG..CA....GC.....G...A..T.A..C..A...GGT...C.......A- ..A........AAGA....CC.CCAAGTCC...........CTGCGC................A...........A...............CTG...........G..- -............A...A.C....................A....G.A...T....C..A.C........C..TCTCGG....................C..A ..................A......AA.......G.......... ............T.A.C.AAG.C.G........................T.. GG....G................-- .G................-- ...G............AGG.CC......---      158    106 ,    106     96     30:>A/great cormorant/Qinghai/3/2005           
 31 >A/peregrine falcon/Hong Kong/D0028/2004    .AC.C.AG.T.T...AG...........C........G..G..AT.G.....T..GA.........G..........T.G....A....- ..........A..GAA.AC....C...............A...........C.A.C.................................T........A.......A.- -C..T...A.C....................G.T.....C.A.....A.........T..............C.......G......G.....T......C.. --------------------------------------------- ---------------------------------------------------- ------------------------- ....GG.............. C........G....A..G..C...AA....-      494    186 ,     98     60     31:>A/peregrine falcon/Hong Kong/D0028/2004    
 32 >A/Ck/Fujian/1042/2005                      .A..C.AG.......AG...................C...G...T.G........GA.........G............G....A....- C.........A.......C..................................A.................................T...........C......A.- -C............A................G..T....C.A.....A..A......T...........T..C.......G......G............C.. --------------------------------------------- ---------------------------------------------------- ------------------------- ......A.A.........A. CT.......G.C..................-      446    169 ,     51     43     32:>A/Ck/Fujian/1042/2005                      
 33 >A/Gs/Shantou/2216/2005,China,2005          .A..C.AG.......AG.................G.....G..AT.G........GA.........G............G....A....- C.........A.......C....................A.............A....................................................A.- -C.............................G.......C.A.....A.........T..............C.......G......G............C.. --------------------------------------------- ---------------------------------------------------- ------------------------- ......A.A........... C.....T..G....................-      450    163 ,     56     37     33:>A/Gs/Shantou/2216/2005,China,2005          
 34 >A/Dk/Fujian/897/2005                       .A..C.AG.......AG...................C...G...T.G........GA.........G............G....A....- C.........A.......C..................................A.................................T......G....C......A.- -C.............................G..T....C.A.....A..A......T...........T..C.......G......G............C.. --------------------------------------------- ---------------------------------------------------- ------------------------- ......A.A.........A. C........G.C..................-      446    168 ,     51     42     34:>A/Dk/Fujian/897/2005                       
 35 >A/Ck/Liaoning/23/2005                      ....C.AG.......A...........T....A.............................................T.........A- ......C...A..........A........................................T.....................T...............T...G...- -.T.......................................T........................G.............G...............A..C.. --------------------------------------------- G.........G...................A.......G......T...... ...............T.......-- C...........A.....-- C..................G........---      235     86 ,     36     31     35:>A/Ck/Liaoning/23/2005                      
 36 >A/guinea fowl/Shantou/1341/2006            ....C.AG.......A...........T..................................................T..........- ......C...A..........A........................................T.....................T...............T...G...- -.T.......................................T........................G..C..........G...............A..C.. ................C..........G...T..........--- G.........G...................A.......G......T...... ...............T.....A.-- C................... C..................G..........-       91     42 ,     48     33     36:>A/guinea fowl/Shantou/1341/2006            
 37 >A/pied magpie/Liaoning/7/2005              ....C.AG.......A...........T..C...............................................T...A...C.A- ......C...A..........A........................................T......A.............AC...............T...G...- -.T.......................................T........................G.............G...............A..C.. ................C..........G...T............. G.........G................T..A.......G......T...... ..............AT.......-- C.................-- C..................G.......G---      107     50 ,     55     40     37:>A/pied magpie/Liaoning/7/2005              
 38 >A/Dk/Novosibirsk/56/2005                   ....C.AG.......A.........................................................................A ..........A...A.............................................................C................................ ...............................................................................T............A.......C.. ...............................T............. ..........G...................A..................... ...............T....T...- .................... C..............................       50     18 ,     34     17     38:>A/Dk/Novosibirsk/56/2005                   
 39 >A/Azerbaijan/008-208/2006                  ---GC.AG.......A..A.............A..............G.....T...G...............................- ..........A.A..A................A........................................................T..................- --.C.A..............T..............T.......................................................GA.......CA. -..C.........G.........C..................... ..........G......A............AC.C..........G......- ........C....C.TT.C....-- -------------------- C....T..T..............G..C...-      183     74 ,     73     42     39:>A/Azerbaijan/008-208/2006                  
 40 >A/Ck/Afghanistan/1207/2006                 ...GC.AG.......A..A............................G.....T...G................................ ..........A....A.........................................................................T..................- -..C.A..............T...........T..T....................................................A...........C.. ...C.........G.........C..................... ..........G...................AC.C..........G....... ....T...C......TT...T..-- .................... C....T..T..............G..C...-       87     42 ,     62     37     40:>A/Ck/Afghanistan/1207/2006                 
 41 >A/Egypt/902782/2006                        ---.C.AG.......A.....A.............T...................................T.................- ..........A..............................................................................T......T..........CA -................................................................C..................................C.. -...........G............A.....T............. ...A......G.T....A............A....................- ....T....G.....T..C..A.-- .................... C......T...........G..........-      136     40 ,     83     30     41:>A/Egypt/902782/2006                        
 42 >A/whooper swan/Mongolia/13/2005            ....C.AG.......A.....A.............T............................A......TA................- ..........A.....................................................................................T......A....- -...................................................................................................C.C .......C.......A..........A.................C ...A......G...................A.................C... .........G.....T......... ..................-- C......T...........G........---       90     35 ,     47     27     42:>A/whooper swan/Mongolia/13/2005            
 43 >A/ruddy shelDk/Qinghai/1/2005              ------------------------------------------------------------------------------------------ ............................................................................................................- -..............A..........................................................................A............ .A.......................A..A.......T........ .................................................... ...A...............G...-- ..................-- ......................M.....---      285    108 ,     15      9     43:>A/ruddy shelDk/Qinghai/1/2005              
 44 >A/bar-headed Gs/Qinghai/62/2005            .........................................................................................- ............................................................................................................A -...................................................................................................... ..........................................--- .................................................... .......................-- .................... ..............................-       39      9 ,      3      1     44:>A/bar-headed Gs/Qinghai/62/2005            
 45 >A/bar-headed Gs/Qinghai/12/2005            .........................................T...............................................- ............................................................................................................- -......................................................................C............................... .........................A................--- .................................................... .......................-- .................... ..............................-       50     12 ,      7      3     45:>A/bar-headed Gs/Qinghai/12/2005            
 46 >A/bar-headed Gs/Qinghai/61/2005            .........................................................................................- .............................C..............................................................................- -.....................A................................................................................ .........................A................--- ...................................................- .......................-- .................... ..............................-       49     13 ,      7      3     46:>A/bar-headed Gs/Qinghai/61/2005            
 47 >A/black-headed gull/Qinghai/1/2005         ---..........................................G.....................................A.....- -......................................................C----------------------------------------------------- --....................................................................................................- -........................A....A..........T--- ...................................................- .....................---- ...................G -............................T-      192     80 ,      8      8     47:>A/black-headed gull/Qinghai/1/2005         
 48 >A/black-headed Gs/Qinghai/1/2005           ---......................................T.............................................G.- -......................................................C----------------------------------------------------- --.....................................................................C..............................- -.T......................A...............T--- ...................................................- .....................---- .................... -...........................AT-      197     81 ,     13      9     48:>A/black-headed Gs/Qinghai/1/2005           
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
---Index----------------------------------------GGTAAGGATCTCATCGATGCTGGGCACGTTGGGGAATAGAACTGCAAATTTGCCGAGAGGTGACGAAAGGGGGGAACCCATTGGGGAAGG TTGGAATGAAGGGAGGAGTTTGATGTACTTTAGGAGCAGGATCTTATAGCCTCGCTCTAGACCGCAATTTACGGTGTTAAAGAGATTCACTTCTATCAGTCGTGAACAG TTGTCGAAGTTAGGGGAGATCAGCGTTGCGTACCCCAGGGGGCCAAAGCCGCGAGATCGGTTCCCTTTACTTTCTCGATCAATCAAAAGGCAGCAGGGTTTGG AGCTAGATAGGTAAGGTAGGTAATCGGAGCGCAATCCGGTACATA ACTGGTAGAGAGCGGCAGGTAGAGAGTCACGTGTTTAGATAGGGAAAATCAG AACCCTATTAAGTTGCCTTACGTTC TAGTAAGGGGACGATGGGGA TAGAGCCCCACTGAGACACATAAAGGTAGCA 
-codon-position---------------------------------  1   12   22           1 1   12  2  1      21             1 2 1  12 2  221   2    2    11 21221 22222222222    2         1      2 2 1 22  1   1  1 2      1    12 2 2    11  1  2    2 1          212 2 2                   11    1      1   1       212    2 1         1   1   1 2 12    21       1   2  111 1 122222212 22   12 1222 22  222222222211 22 12 1   2 1 1 2        1        2          2   12  1       2  11   12112112112111  1 11111111111 1 11 2 2    1   1  1    1  211211 1122 
                                                000000000000000000000000000011111111111111111111111111111111111111111111111112222222222222 0000000000000000000000000000000001111111111111111111111111111111111111111111111111111111111111112222222222222 0000000000000000000000000000000000000000011111111111111111111111111111111111111111111111111111111111222 000000000000000000000000011111111111111111111 0000000000000000000000000000000000000111111111111111 0000000000000011111111111 00000000000000000001 0000000000000000000000000000000 
                                                000122333344445556778888899900011111122223333455555666777778888888999999999990000001111123 0011222444555666667788888999999990000011111111222222223333333334444444444555556677788888888888880000000223333 0011222223334444555556667788888888899999900011111111122222233344444555556666667777778888888888999999011 011222234455555667777888900011223344555566777 1122233333333444455566666666666778899000001122222235 1122333677788911111223344 22345555777778888990 1222233333344444555666666667788 
                                                456026666878893685082458869900201247713380569600358169123451136689222346689991334472246923 5844348258248336891302567333668892346803677799013589990111222590223455677012244414803334466667791234677570013 2416445780173389034497999911355778914578924901234588933359925704478346793666660488990123457899146689947 648359957713667773559159837829582299125907667 5728945555569145701501122346669190366344484856888944 4519034217844100136365956 04447888345894559135 0023401456844559047022455881928 
                                                871827129772521484268985604625499886933615957206077152984323553473489415720289076960423645 9206501225451258667274813039034899242304634639924416795279369924087026905611757840840355803890899516736062906 9278098680522592110620692846728690725524001848666525901373660410165063830245677025029573818869492513280 135610623486470078181886681576692839422619458 7785082457963419473335814623596727406846709036157348 7924916417727635132784391 89621039984430082068 1124918247478698140635938248911

Deadly bird flu strain found in Germany

Retired

Retired

Retired

Registered User

Retired

Retired

Retired

Retired

Registered User

Retired

Retired

Well-known member

Retired

Retired

Retired

Registered User

Retired

Registered User

Retired

Registered User