A/Shanghai/60T/2009(H1N1) released 6/22

[AlaskaDenise]

PB2 released Mon. 6/22/09:
GQ290434 2280 Human 1 H1N1 China 2009/05/28 Influenza A virus (A/Shanghai/60T/2009(H1N1)


LOCUS GQ290434 2280 bp cRNA linear VRL 22-JUN-2009
DEFINITION Influenza A virus (A/Shanghai/60T/2009(H1N1)) segment 1 polymerase
PB2 (PB2) gene, complete cds.
ACCESSION GQ290434
VERSION GQ290434.1 GI:241149115
DBLINK Project:37813
KEYWORDS .
SOURCE Influenza A virus (A/Shanghai/60T/2009(H1N1))
ORGANISM Influenza A virus (A/Shanghai/60T/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 2280)
AUTHORS Hu,Y., Song,Z., Tian,D., He,J., Zhou,Z., Zhang,X., Guan,W., Yin,K.,
Wu,M., Chen,Z., Zhang,X., Lu,H., Zhang,Z. and Yuan,Z.
TITLE Genetic Characterization of Swine-Origin 2009 A (H1N1) Influenza
Viruses Isolated in Shanghai
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 2280)
AUTHORS Hu,Y., Song,Z., Tian,D., He,J., Zhou,Z., Zhang,X., Guan,W., Yin,K.,
Wu,M., Chen,Z., Zhang,X., Lu,H., Zhang,Z. and Yuan,Z.
TITLE Direct Submission
JOURNAL Submitted (21-JUN-2009) Research Unit, Shanghai Public Health
Clinical Center Affiliated to Fudan University, Caolang Road 2901,
Shanghai 201508, China
COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
outbreak of 2009.
FEATURES Location/Qualifiers
source 1..2280
/organism="Influenza A virus (A/Shanghai/60T/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/Shanghai/60T/2009"
/serotype="H1N1"
/host="Homo sapiens"
/db_xref="taxon:654419"
/segment="1"
/country="China"
/collection_date="28-May-2009"
/note="lineage: swl"
gene 1..2280
/gene="PB2"
CDS 1..2280
/gene="PB2"
/codon_start=1
/product="polymerase PB2"
/protein_id="ACS66827.1"
/db_xref="GI:241149116"
/translation="MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSG RQEKNPA
LRMKWMMAMRYPITADKRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPL AVTWWNRN
GPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPGHA DLSAKEAQ
DVIMEVVFPNEVGARILTSESQLAITKEKKEELQDCKIAPLMVAYMLERE LVRKTRFL
PVAGGTGSVYIEVLHLTQGTCWEQMYTPGGEVRNDDVDQSLIIAARNIVR RAAVSADP
LASLLEMCHSTQIGGVRMVDILRQNPTEEQAVDICKAAIGLRISSSFSFG GFTFKRTS
GSSVKKEEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQL IVSGRDEQ
SIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDA KVLFQNWG
IESIDNVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDR FLRVRDQR
GNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTYQWIIRNWE IVKIQWSQ
DPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLFQQMRDVLGTFDTVQII KLLPFAAA
PPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNKATKRLTVLGKDAGA LTEDPDEG
TSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVV LVMKRKRD
SSILTDSQTATKRIRMAIN"
ORIGIN
1 atggagagaa taaaagaact gagagatcta atgtcgcagt cccgcactcg cgagatactc
61 actaagacca ctgtggacca tatggccata atcaaaaagt acacatcagg aaggcaagag
121 aagaaccccg cactcagaat gaagtggatg atggcaatga gatacccaat tacagcagac
181 aagagaataa tggacatgat tccagagagg aatgaacaag gacaaaccct ctggagcaaa
241 acaaacgatg ctggatcaga ccgagtgatg gtatcacctc tggccgtaac atggtggaat
301 aggaatggcc caacaacaag tacagttcat taccctaagg tatataaaac ttatttcgaa
361 aaggtcgaaa ggttgaaaca tggtaccttc ggccctgtcc acttcagaaa tcaagttaaa
421 ataaggagga gagttgatac gaaccctggc catgcagatc tcagtgccaa ggaggcacag
481 gatgtgatta tggaagttgt tttcccaaat gaagtggggg caagaatact gacatcagag
541 tcacagctgg caataacaaa agagaagaaa gaagagctcc aggattgtaa aattgctccc
601 ttgatggtgg cgtacatgct agaaagagaa ttggtccgta aaacaaggtt tctcccagta
661 gccggcggaa caggcagtgt ttatattgaa gtgttgcact taacccaagg gacgtgctgg
721 gagcagatgt acactccagg aggagaagtg agaaatgatg atgttgacca aagtttgatt
781 atcgctgcta gaaacatagt aagaagagca gcagtgtcag cagacccatt agcatctctc
841 ttggaaatgt gccacagcac acagattgga ggagtaagga tggtggacat ccttagacag
901 aatccaactg aggaacaagc cgtagacata tgcaaggcag caatagggtt gaggattagc
961 tcatctttca gttttggtgg gttcactttc aaaaggacaa gcggatcatc agtcaagaaa
1021 gaagaagaag tgctaacggg caacctccaa acactgaaaa taagagtaca tgaagggtat
1081 gaagaattca caatggttgg gagaagagca acagctattc tcagaaaggc aaccaggaga
1141 ttgatccagt tgatagtaag cgggagagac gagcagtcaa ttgctgaggc aataattgtg
1201 gccatggtat tctcacaaga ggattgcatg atcaaggcag ttaggggcga tctgaacttt
1261 gtcaataggg caaaccagcg gctgaacccc atgcaccaac tcttgaggca tttccaaaaa
1321 gatgcaaaag tgcttttcca gaactgggga attgaatcca tcgacaatgt gatgggaatg
1381 atcggaatac tgcccgacat gaccccaagc acggagatgt cgctgagagg gataagagtc
1441 agcaaaatgg gagtagatga atactccagc acggagagag tggtagtgag tattgaccga
1501 tttttaaggg ttagagatca aagagggaac gtactattgt ctcccgaaga agtcagtgaa
1561 acgcaaggaa ctgagaagtt gacaataact tattcgtcat caatgatgtg ggagatcaat
1621 ggccctgagt cagtgctagt caacacttat caatggataa tcaggaactg ggaaattgtg
1681 aaaattcaat ggtcacaaga tcccacaatg ttatacaaca aaatggaatt tgaaccattt
1741 cagtctcttg tccctaaggc aaccagaagc cggtacagtg gattcgtaag gacactgttc
1801 cagcaaatgc gggatgtgct tgggacattt gacactgtcc aaataataaa acttctcccc
1861 tttgctgctg ctccaccaga acagagtagg atgcaatttt cctcattgac tgtgaatgtg
1921 agaggatcag ggttgaggat actggtaaga ggcaattctc cagtattcaa ttacaacaag
1981 gcaaccaaac gacttacagt tcttggaaag gatgcaggtg cattgactga agatccagat
2041 gaaggcacat ctggggtgga gtctgctgtc ctgagaggat ttctcatttt gggcaaagaa
2101 gacaagagat atggcccagc attaagcatc aatgaactga gcaatcttgc aaaaggagag
2161 aaagctaatg tgctaattgg gcaaggggac gtagtgttgg taatgaaacg aaaacgggac
2221 tctagcatac ttactgacag ccagacagcg accaaaagaa ttcggatggc catcaattag
//

[AlaskaDenise]

Re: A/Shanghai/60T/2009(H1N1) released 6/22

using the new tracking tool that Toaster showed us (http://mammalia.gsc.riken.jp/swine_influenza/),

we can look directly at position 627 in the mutation frame.

Below the title "[PB2 of A/Shanghai/60T/2009(H1N1) : GQ290434] Mutation information - Multiple alignment against 52 PB2 sequences of swine influenza [H1N1]"

We can scroll down to position 627, where we find:

627E K GQ253501

To rephrase the explanation from their HELP menu:

This frame includes the mutation information for this protein.
The amino acid residues that the mutation was observed in other strains of swine influenza are listed.

For example, {627E - K - GQ253501 } indicates that the 627th resides (Glutamic acid) this protein was mutated to Lysine on the sequence of GQ253501.

GQ253501 is Shanghai/70T - the one we know carries 627K

.

[gsgs]

Re: A/Shanghai/60T/2009(H1N1) released 6/22

what maybe you wanted to say :

it has 627E, not the mutation of Shanghai/71T

nor any other of the potetially dangerous mutations in the end-area of PB2 which
we saw in Shanghai/71T

[AlaskaDenise]

Re: A/Shanghai/60T/2009(H1N1) released 6/22

I didn't say it was like Shanghai/71T!

I was copying directly from the Japanese site.

Their HELP menu for the mutation frame (on the useable page), is what I copied, substituting the actual contents of their mutation comparisons.

If you use the site, you'll understand the meaning. What their chart is saying is: - compared to the 627E present in the new Shanghai/60T sample, these are the other values in other PB2s and it names their associated sequence numbers. In this case they pointed to the "K" in Shanghai/70T

I was trying to show how anyone could use the tool to find differences between sequences.

have you used the site?

.

[gsgs]

Re: A/Shanghai/60T/2009(H1N1) released 6/22

I've looked at it a bit, but I'm using my own programs, as you know.
I may look again at it later and try more.

When I want to find other viruses with a certain mutation,
then I usually just look at my mutation tables

[AlaskaDenise]

Re: A/Shanghai/60T/2009(H1N1) released 6/22

Good that you have some tools you're comfortable with. For people with a less-than-in-depth understanding of the genetics here, some of these pre-programmed tools are very helpful.

I don't understand it all yet, but it's nice to learn a little more.

The Japanese researchers did a great job and it is fantastic that they are releasing their work to the global community.

.

[gsgs]

Re: A/Shanghai/60T/2009(H1N1) released 6/22

they should give a list of mutations (from the calculated index)
with each released sequence, or even instead of that sequence
(the sequence can be constructed from it)

Also the count, how often that mutation occurred already
and on request(clicking) a list of other mutations
that occurred together with that mutation and how often.
Also on click a list of closest related sequences
sorted by #of differences

It can be done and isn't so difficult.
But it's rather specific and doesn't easily apply to other
(non-flu) sequences, so there is not so much interest,
I assume

[AlaskaDenise]

Re: A/Shanghai/60T/2009(H1N1) released 6/22

To clarify and credit the site Toaster2 referenced:

location: http://mammalia.gsc.riken.jp/swine_influenza/

credits:

References
Ogata K. and Umeyama H., J. Mol. Graph. Model 18, 258-272, 305-306 (2000)
Terashi G, Takeda-Shitaka M, Kanou K, Iwadate M, Takaya D, Hosoi A, Ohta K, Umeyama H, Proteins., 69 Suppl 8, 98-107 (2007)
Takeda-Shitaka M, Terashi G, Takaya D, Kanou K, Iwadate M, Umeyama H., Proteins., 61 Suppl 7, 122-7 (2005)

URL http://mammalia.gsc.riken.jp/swine_influenza/

Title Swine influenza (H1N1) protein structure model database
Kazuhiko Kanou,a Yuuki Nakamura,a Genki Terashi,a Mitsuo Iwadate,b,c Daisuke Takaya,b Takehisa Matsumoto,b Mayuko Takeda-Shitaka,a,b and Hideaki Umeyamaa,b

aSchool of Pharmacy, Kitasato University, 5-9-1 Shirokane, Minato-ku, Tokyo 108-8641, Japan
bRIKEN Systems and Structural Biology Center, 1-7-22 Suehiro-cho, Tsurumi-ku, Yokohama 230-0045, Japan
cDepartment of Biological Sciences, Faculty of Science and Engineering, Chuo University; Kasuga 1-13-27, Bunkyo-ku, Tokyo 112-8551, Japan

.

[HenryN]

Re: A/Shanghai/60T/2009(H1N1) released 6/22

using the new tracking tool that Toaster showed us (http://mammalia.gsc.riken.jp/swine_influenza/),

we can look directly at position 627 in the mutation frame.

Below the title "[PB2 of A/Shanghai/60T/2009(H1N1) : GQ290434] Mutation information - Multiple alignment against 52 PB2 sequences of swine influenza [H1N1]"

We can scroll down to position 627, where we find:



To rephrase the explanation from their HELP menu:



GQ253501 is Shanghai/70T - the one we know carries 627K

.

Speaking of 70T, the PB1 travel log for 60T below contains a number of Shanghai isolates, which adds to the evidence that E627K is on a Shanghai backbone and therefore was acquired in Shanghai (and not in NY or Hong Kong) - 60T isn't listed because it is new and not in the search database yet

gb|GQ253500.1| Influenza A virus (A/Shanghai/71T/2009(H1N1)) ... 34.2 2.8
gb|GQ253490.1| Influenza A virus (A/Shanghai/37T/2009(H1N1)) ... 34.2 2.8
gb|GQ225355.1| Influenza A virus (A/Shanghai/1/2009(H1N1)) se... 34.2 2.8
gb|GQ200234.1| Influenza A virus (A/Georgia/01/2009(H1N1)) se... 34.2 2.8
gb|GQ166208.2| Influenza A virus (A/Bayern/63/2009(H1N1)) seg... 34.2 2.8
gb|GQ168887.1| Influenza A virus (A/Ohio/07/2009(H1N1)) segme... 34.2 2.8
gb|CY040360.1| Influenza A virus (A/Hong Kong/HKU77/2005(H3N2... 34.2 2.8
gb|CY040048.1| Influenza A virus (A/New York/3007/2009(H1N1))... 34.2 2.8
gb|GQ160544.1| Influenza A virus (A/Ohio/07/2009(H1N1)) segme... 34.2 2.8
gb|GQ132180.1| Influenza A virus (A/Canada-ON/RV1526/2009(H1N... 34.2 2.8
gb|CY023718.1| Influenza A virus (A/chicken/Guangxi/187/2005(... 34.2 2.8
gb|CY023702.1| Influenza A virus (A/chicken/Guangxi/2441/2004... 34.2 2.8
gb|CY023694.1| Influenza A virus (A/chicken/Guangxi/1857/2004... 34.2 2.8
gb|EF551051.1| Influenza A virus (A/swine/North Carolina/2003... 34.2 2.8
gb|CY021771.1| Influenza A virus (A/South Australia/53/2005(H... 34.2 2.8
gb|CY017923.1| Influenza A virus (A/Queensland/28/2002(H3N2))... 34.2 2.8
gb|EF101748.1| Influenza A virus (A/Philippines/344/2004(H1N2... 34.2 2.8
gb|CY015682.1| Influenza A virus (A/Western Australia/13/2001... 34.2 2.8

[HenryN]

Re: A/Shanghai/60T/2009(H1N1) released 6/22

PA travel log

gb|GQ290436.1| Influenza A virus (A/Shanghai/60T/2009(H1N1)) ... 38.2 0.18
gb|GQ267855.1| Influenza A virus (A/Shiga/1/2009(H1N1)) segme... 38.2 0.18
gb|GQ253496.1| Influenza A virus (A/Shanghai/37T/2009(H1N1)) ... 38.2 0.18
gb|GQ253488.1| Influenza A virus (A/Zhejiang/2/2009(H1N1)) se... 38.2 0.18
gb|GQ225356.1| Influenza A virus (A/Shanghai/1/2009(H1N1)) se... 38.2 0.18
gb|EU148425.1| Influenza A virus (A/chicken/Nigeria/1071-22/2... 38.2 0.18
gb|EU148409.1| Influenza A virus (A/chicken/Nigeria/1071-10/2... 38.2 0.18
gb|EF597400.1| Influenza A virus (A/duck/Hong Kong/394/1978(H... 38.2 0.18
gb|CY021530.1| Influenza A virus (A/turkey/Italy/1258/2005(H5... 38.2 0.18
gb|CY017280.1| Influenza A virus (A/mallard/Ohio/265/1987(H1N... 38.2 0.18
gb|DQ280199.2| Influenza A virus (A/swine/Alberta/56626/03(H1... 38.2 0.18
gb|CY005820.1| Influenza A virus (A/duck/Czechoslovakia/1956(... 38.2 0.18
gb|CY005817.1| Influenza A virus (A/duck/UKR/1/1963(H3N8)) se... 38.2 0.18
gb|AF156450.1|AF156450 Influenza A virus (A/Chicken/Hong Kong... 38.2 0.18
gb|M55473.1|FLAPAB Influenza A virus (A/swine/1976/1931(H1N1)... 38.2 0.18

[HenryN]

Re: A/Shanghai/60T/2009(H1N1) released 6/22

The sequences in China are NOT recent imports.

[gsgs]

Re: A/Shanghai/60T/2009(H1N1) released 6/22

71T is different from the other Shanghai-viruses, which I think
came from Australia.

this Ohio,Bayern group of 7 has 2 additional markers
of which 71T has G1161A(2) but lacks G1282A(4).

But it also lacks C1140T(4) and A742G(6) from the 11 standard
Cancun-markers.

This is strange and made me speculate about reassortment,
but that can't explain it either


no Shanghai background IMO
more likely one certain hotel or place in Cancun, mid April

[gsgs]

Re: A/Shanghai/60T/2009(H1N1) released 6/22

                                           00112222222 1 00 00111 000000111 00000000111 0000 00000 
                                           34280011122 1 06 67024 127888112 35666779222 4679 23457 
                                           04873300644 6 43 51080 195015444 18999453258 9027 96842 
                                           31192818349 1 00 86128 781436368 68789270163 2033 17979 
-codon-position----------------------------   11112  2   1  12211  11  1    1 12 11  22    1  1 1  
---Index-----------------------------------GAAGGGGGGGC G GT TAGGC CGGAAGGAG GTTGTATGTGG GGGG AAAGG 
  2 >A/Shanghai/1/2009/05/23               .GG.....R.. A A. A..AT .A....A.A A....G..... AA.. GGGAA       20     20 ,     20     20      2:>A/Shanghai/1/2009/05/23               
  6 >A/Shanghai/60T/2009/05/28             .GG.....A.. A A. ----- .A....A.A ----------- AA.. GG..A       29     29 ,     13     13      6:>A/Shanghai/60T/2009/05/28             
  3 >A/Shanghai/37T/2009/05/24             AGG.....A.. A A. A..AT TA....A.A A.GTGGAT... AAA. GG..A       26     26 ,     26     26      3:>A/Shanghai/37T/2009/05/24             
  1 >A/Shanghai/71T/2009/05/31             ...AAAAAA.. A .. A.... .A.GTAAGA AC......CAA AA.. .G...       23     23 ,     23     23      1:>A/Shanghai/71T/2009/05/31             
  5 >A/Newflu/Cancun-NY/Index/2009-04-15   ........A.. . .. A...T .A....A.A A....G..... AA.. .G...       11     11 ,     11     11      5:>A/******/Cancun-NY/Index/2009-04-15   
  7 >A/Bayern/63/2009//                    ........ATA A .. A..AT .A....A.A A....G..... AA.C .G...       16     16 ,     16     16      7:>A/Bayern/63/2009//                    
  8 >A/Ohio/07/2009/04/24                  ........A.. A .. A.A-- .AA...A.A A....G..... AA.. .G...       15     15 ,     13     13      8:>A/Ohio/07/2009/04/24                  
  9 >A/NY/3007/2009/04/27                  ........A.. A .. A..AT .A....A.A A....G..... AA.. .G...       13     13 ,     13     13      9:>A/NY/3007/2009/04/27                  
 10 >A/Georgia/01/2009/04/27               ........A.. A -- AG.AT .A....A.A A....G..... AA.. .G...       16     16 ,     14     14     10:>A/Georgia/01/2009/04/27               
 11 >A/Canada-ON/RV1526/2009//             ........A.. A .C W..AT .A....A.A A....G..... AA.. .G...       14     14 ,     14     14     11:>A/Canada-ON/RV1526/2009//             
  4 >A/Newflu/index/2009-02-01             ........... . .. ..... ......... ........... .... .....        0      0 ,      0      0      4:>A/******/index/2009-02-01

[HenryN]

Re: A/Shanghai/60T/2009(H1N1) released 6/22

Here is the full PB1 travel log (which shows that 60T, and 71T, are with the other Shanghai sequences)

gb|GQ290435.1| Influenza A virus (A/Shanghai/60T/2009(H1N1)) ... 32.2 11 28-May-2009
gb|GQ253500.1| Influenza A virus (A/Shanghai/71T/2009(H1N1)) ... 32.2 11
gb|GQ253490.1| Influenza A virus (A/Shanghai/37T/2009(H1N1)) ... 32.2 11 24-May-2009
gb|GQ225355.1| Influenza A virus (A/Shanghai/1/2009(H1N1)) se... 32.2 11 23-May-2009 30M
gb|GQ200234.1| Influenza A virus (A/Georgia/01/2009(H1N1)) se... 32.2 11 27-April
gb|GQ166208.2| Influenza A virus (A/Bayern/63/2009(H1N1)) seg... 32.2 11
gb|GQ168887.1| Influenza A virus (A/Ohio/07/2009(H1N1)) segme... 32.2 11 24-Apr-2009 9M
gb|GQ160544.1| Influenza A virus (A/Ohio/07/2009(H1N1)) segme... 32.2 11
gb|GQ132180.1| Influenza A virus (A/Canada-ON/RV1526/2009(H1N... 32.2 11
gb|CY039173.1| Influenza A virus (A/Hong Kong/HKU24/2004(H3N2... 32.2 11
gb|CY040360.1| Influenza A virus (A/Hong Kong/HKU77/2005(H3N2... 32.2 11
gb|CY040048.1| Influenza A virus (A/New York/3007/2009(H1N1))... 32.2 11 27-Apr-2009 33Y
gb|CY039173.1| Influenza A virus (A/Hong Kong/HKU24/2004(H3N2... 32.2 11
gb|CY037861.1| Influenza A virus (A/Ohio/UR07-0023/2008(H3N2)... 32.2 11
gb|CY037525.1| Influenza A virus (A/Ohio/UR07-0031/2008(H3N2)... 32.2 11
gb|EF551051.1| Influenza A virus (A/swine/North Carolina/2003... 32.2 11
gb|CY021771.1| Influenza A virus (A/South Australia/53/2005(H... 32.2 11
gb|CY017923.1| Influenza A virus (A/Queensland/28/2002(H3N2))... 32.2 11
gb|EF101748.1| Influenza A virus (A/Philippines/344/2004(H1N2... 32.2 11
gb|CY015682.1| Influenza A virus (A/Western Australia/13/2001... 32.2 11
gb|CY000071.1| Influenza A virus (A/New York/45/2003(H3N2)) s... 32.2 11

[HenryN]

Re: A/Shanghai/60T/2009(H1N1) released 6/22

PB2 travel log

gb|GQ290434.1| Influenza A virus (A/Shanghai/60T/2009(H1N1)) ... 40.1 0.046
gb|GQ253489.1| Influenza A virus (A/Shanghai/37T/2009(H1N1)) ... 40.1 0.046
gb|GQ225354.1| Influenza A virus (A/Shanghai/1/2009(H1N1)) se... 40.1 0.046
gb|EU980493.1| Influenza A virus (A/mallard/MD/865/2002(H5N2)... 40.1 0.046
gb|EU980501.1| Influenza A virus (A/mallard/MD/898/2002(H5N2)... 40.1 0.046
gb|EU980508.1| Influenza A virus (A/mallard/MD/185/2003(H5N2)... 40.1 0.046
gb|CY029936.1| Influenza A virus (A/blue-winged teal/Ohio/186... 40.1 0.046
gb|EU050626.1| Influenza A virus (A/chukkar/Shantou/1530/2005... 40.1 0.046
gb|EU050621.1| Influenza A virus (A/chukkar/Shantou/89/2005(H... 40.1 0.046
gb|EU050619.1| Influenza A virus (A/chukkar/Shantou/7964/2004... 40.1 0.046
gb|EU050615.1| Influenza A virus (A/chukkar/Shantou/6865/2004... 40.1 0.046
gb|EU050613.1| Influenza A virus (A/quail/Shantou/6651/2004(H... 40.1 0.046
gb|EU050610.1| Influenza A virus (A/quail/Shantou/6060/2004(H... 40.1 0.046
gb|EU050609.1| Influenza A virus (A/guinea fowl/Shantou/6042/... 40.1 0.046
gb|EU050608.1| Influenza A virus (A/chukkar/Shantou/5651/2004... 40.1 0.046
gb|EU050606.1| Influenza A virus (A/partridge/Shantou/5028/20... 40.1 0.046
gb|EU050600.1| Influenza A virus (A/guinea fowl/Shantou/3431/... 40.1 0.046
gb|EU050591.1| Influenza A virus (A/guinea fowl/Shantou/2418/... 40.1 0.046
gb|EU050550.1| Influenza A virus (A/quail/Shantou/1811/2001(H... 40.1 0.046
gb|CY023317.1| Influenza A virus (A/chicken/Shantou/2402/2004... 40.1 0.046
gb|EU026013.1| Influenza A virus (A/mallard/Maryland/887/2002... 40.1 0.046
gb|CY021596.1| Influenza A virus (A/mallard/Maryland/899/2002... 40.1 0.046
gb|CY020868.1| Influenza A virus (A/blue-winged teal/Ohio/907... 40.1 0.046
gb|CY020860.1| Influenza A virus (A/mallard/Ohio/664/2002(H6N... 40.1 0.046
gb|CY011119.1| Influenza A virus (A/mallard/Maryland/881/2002... 40.1 0.046
gb|CY020820.1| Influenza A virus (A/mallard/Maryland/470/2002... 40.1 0.046
gb|CY020804.1| Influenza A virus (A/mallard/Ohio/671/2002(H4N... 40.1 0.046
gb|CY020780.1| Influenza A virus (A/mallard/Ohio/655/2002(H4N... 40.1 0.046
gb|CY014525.2| Influenza A virus (A/mallard/Ohio/657/2002(H4N... 40.1 0.046
gb|CY020772.1| Influenza A virus (A/black duck/Maryland/834/2... 40.1 0.046
gb|CY020740.1| Influenza A virus (A/mallard/Maryland/750/2002... 40.1 0.046
gb|EF063554.1| Influenza A virus (A/quail/Dubai/303/2000(H9N2... 40.1 0.046
gb|EF063553.1| Influenza A virus (A/quail/Dubai/302/2000(H9N2... 40.1 0.046
gb|EF063552.1| Influenza A virus (A/quail/Dubai/301/2000(H9N2... 40.1 0.046
gb|CY017732.1| Influenza A virus (A/pintail/Ohio/25/1999(H1N1... 40.1 0.046
gb|CY017724.1| Influenza A virus (A/green-winged teal/Ohio/72... 40.1 0.046
gb|CY016962.1| Influenza A virus (A/mallard/Ohio/66/1999(H1N1... 40.1 0.046
gb|CY014805.1| Influenza A virus (A/turkey/Minnesota/1012/199... 40.1 0.046
gb|CY014701.1| Influenza A virus (A/gull/Maryland/704/1977(H1... 40.1 0.046
gb|CY012831.1| Influenza A virus (A/mallard/Ohio/56/1999(H1N1... 40.1 0.046
gb|AY619970.1| Influenza A virus (A/swine/Ontario/42729A/01(H... 40.1 0.046
gb|AY619962.1| Influenza A virus (A/swine/Ontario/K01477/01(H... 40.1 0.046
gb|AF508647.1| Influenza A virus (A/Pheasant/Ireland/PV18/97(... 40.1 0.046
gb|CY005071.1| Influenza A virus (A/laughing gull/DE/2838/198... 40.1 0.046
gb|CY004567.1| Influenza A virus (A/herring gull/DE/712/1988(... 40.1 0.046
gb|CY004457.1| Influenza A virus (A/herring gull/NJ/782/1986(... 40.1 0.046
gb|CY003901.1| Influenza A virus (A/herring gull/DE/475/1986(... 40.1 0.046
gb|CY005865.1| Influenza A virus (A/gull/Minnesota/945/1980(H... 40.1 0.046
gb|CY005858.1| Influenza A virus (A/shoveler/Netherlands/19/1... 40.1 0.046
gb|CY004880.1| Influenza A virus (A/herring gull/DE/665/1988(... 40.1 0.046
gb|CY004389.1| Influenza A virus (A/herring gull/New Jersey/7... 40.1 0.046
gb|M73525.1|FLAH13N6B Influenza A virus (A/gull/Maryland/704/... 40.1 0.046