Announcement

Collapse
No announcement yet.

A/São Paulo/H1N1 - mutation on Hemaglutinina

Collapse
X
  • Filter
  • Time
  • Show
Clear All
new posts

  • A/São Paulo/H1N1 - mutation on Hemaglutinina

    Warning - google translation

    Tue, 16/06/09 - 11h20
    São Paulo isolates of influenza A virus H1N1

    Genetic sequencing revealed that proteins of the virus is not the same standard found in California, genetic characterization will contribute to production of vaccine

    The State of São Paulo has isolated and sequenced, so pioneer in Brazil, the influenza virus A H1N1, popularly known as swine flu. The study was conducted by Instituto Adolfo Lutz, organ of the Secretary of Health, from the material collected in the first case of Sao Paulo disease, confirmed in April.

    Following the guidelines of the World Health Organization (WHO), the Secretary named the new strain of Influenza A / Paulo/H1N1 are. The genetic sequencing revealed a mutation in the hemagglutinin protein, responsible for the ability to infect the virus, which no longer has the same pattern of the virus in California (USA), first isolated in the current pandemic.

    The genetic characterization of the virus is crucial to whether the standard is maintained or have differed from those found in other regions of the world.

    "This work is extremely important to monitor the behavior of the virus, which will contribute to the production of the vaccine and to assess the response to anti-viral," says Martha Solomon, director of the Institute Adolfo Lutz.

    So far were recorded in the 27 cases of influenza A H1N1. 21 other cases are considered suspect and are being investigated. No death by disease in São Paulo.

    Eighteen hospitals across the state serve as reference for treatment of suspected cases of the new flu. These units have beds for isolation and are in readiness to identify any case, report the fact immediately to the Center of Epidemiological Surveillance (CVE) and the Secretariat to take samples of nasal and throat secretions of patients.

    The virological examinations are being conducted at the Instituto Adolfo Lutz, one of three references to the national identification of influenza that meets standards of biosecurity needed for the manipulation of viruses.

    Department of Health

    Source: http://www.saopaulo.sp.gov.br/spnoti....php?id=202024

    _______________________
    Original post in portuguese:

    Ter, 16/06/09 - 11h20
    São Paulo isola vírus da gripe A H1N1

    Seqüenciamento genético revela que proteína do vírus não é do mesmo padrão do encontrado na Califórnia; caracterização genética contribuirá para produção de vacina

    O Estado de São Paulo conseguiu isolar e seqüenciar, de forma pioneira no Brasil, o vírus da gripe A H1N1, popularmente conhecida como gripe suína. O trabalho foi realizado pelo Instituto Adolfo Lutz, órgão da Secretaria de Estado da Saúde, a partir do material colhido do primeiro caso paulista da doença, confirmado em abril.

    Seguindo as diretrizes da Organização Mundial de Saúde (OMS), a Secretaria denominou a nova estirpe de Influenza A/São Paulo/H1N1. O seqüenciamento genético revelou uma mutação na proteína Hemaglutinina, responsável pela capacidade de infectar do vírus, que já não tem o mesmo padrão do vírus da Califórnia (EUA), o primeiro isolado na atual pandemia.

    A caracterização genética do vírus é fundamental para saber se o padrão se mantém ou já diferenciou dos encontrados em outras regiões do mundo.

    "Esse trabalho é de extrema importância para monitorar o comportamento do vírus, o que irá contribuir para a produção da vacina e para avaliar a resposta aos medicamentos anti-virais", afirma Marta Salomão, diretora do Instituto Adolfo Lutz.

    Até o momento foram registrados no Estado 27 casos de gripe A H1N1. Outros 21 casos são considerados suspeitos e estão sendo investigados. Não há nenhum óbito pela doença em São Paulo.

    Dezoito hospitais em todo o Estado funcionam como referência para atendimento de casos suspeitos da nova gripe. Essas unidades possuem leitos de isolamento e ficam de prontidão para identificar qualquer caso, comunicar o fato imediatamente ao Centro de Vigilância Epidemiológica (CVE) da Secretaria e colher amostras de secreções nasais e da garganta dos pacientes.

    Os exames virológicos estão sendo realizados no Instituto Adolfo Lutz, uma das três referências nacionais para a identificação da influenza que atende às normas de biossegurança necessária para a manipulação de vírus.

    Da Secretaria da Saúde

    Fonte: http://www.saopaulo.sp.gov.br/spnoti....php?id=202024

  • #2
    Re: A/São Paulo/H1N1 - mutation on Hemaglutinina

    More information about it:

    Warning - automatic translation -


    Tuesday, June 16, 2009, 13:17 | Online

    Adolfo Lutz isolated variant of the H1N1 virus that arrived in Brazil

    The sequencing will contribute to the production of influenza vaccine and evaluation of response to antiviral

    Ana Conception of the State Agency

    Adolfo Lutz isolated variant of the H1N1 virus that arrived in Brazil
    SÃO PAULO - The Institute Adolfo Lutz, Department of Health of São Paulo, announced the isolation of a subtype of H1N1, known as swine flu virus, an important step for the Brazilian production of vaccine against the disease. The isolation was done by the team of virology Terezinha Maria de Paiva.





    The isolation of the virus made possible the genetic sequencing of the Brazilian strain of the virus, which was called A / Paulo/1454/H1N1 are. According to notes of the Institute, the genetic characterization is essential in the investigation of molecular epidemiology of the virus, whether the standard is maintained viral or has differed from those found in other regions of the world.



    According to the researchers, although this virus has some differences with the first copy of strain A (H1N1) idenficado in the United States, called the California virus, it would still be vulnerable to a vaccine created to combat it.



    The sequencing will also contribute to the production of influenza vaccine and evaluation of the response of patients to antiviral.



    In Chicago, the first case of human infection caused by the new strain of virus was identified in a man of 26 years who presented the symptoms of flu to return from a trip to Mexico.



    The patient was hospitalized on April 24 at the Institute of Infectious Diseases Emilio Ribas and recovered it. Respiratory secretion sample of this patient was investigated by researchers of the Adolfo Lutz, who later isolated the virus. As this virus was imported from Mexico, is not yet possible to say whether he will be the predominant form of the disease in Brazil.



    In bulletin issued on the afternoon of Monday, 15, the Ministry of Health confirmed 74 cases in the country, most concentrated in the states of São Paulo, Santa Catarina and Rio de Janeiro.



    The total of confirmed cases of the disease in the world is at least 37 thousand, according to World Health Organization (WHO) and international agencies. Since it emerged in Mexico in April this year the disease killed at least 163 people, mostly in North America.



    (with Alexandre Gonçalves, O Estado de S. Paulo)

    Source: http://www.estadao.com.br/noticias/vidae, adolfo-lutz-iso-Brazilian-variant-virus-of-the-flu-fever, 388181.0. Htm


    __________
    Original post:


    terça-feira, 16 de junho de 2009, 13:17 | Online

    Adolfo Lutz isola variante do vírus H1N1 que chegou ao Brasil

    O sequenciamento vai contribuir para a produção da vacina contra a gripe e avaliação da resposta aos antivirais

    Ana Conceição, da Agência Estado

    Adolfo Lutz isola variante do vírus H1N1 que chegou ao Brasil
    SÃO PAULO - O Instituto Adolfo Lutz, da Secretaria de Saúde de São Paulo, anunciou o isolamento de um subtipo do H1N1, conhecido por vírus da gripe suína, uma etapa importante para a produção da vacina brasileira contra a doença. O isolamento foi feito pela equipe da virologista Terezinha Maria de Paiva.





    O isolamento do vírus tornou possível o sequenciamento genético da estirpe brasileira do vírus, que foi batizado de A/São Paulo/1454/H1N1. De acordo com nota do Instituto, a caracterização genética é fundamental na investigação da epidemiologia molecular do vírus, para saber se o padrão viral se mantém ou já se diferenciou dos encontrados em outras regiões do mundo.



    De acordo com os pesquisadores, embora esse vírus tenha algumas diferenças em relação ao primeiro exemplar da cepa A(H1N1) idenficado nos Estados Unidos, o chamado vírus Califórnia, ele ainda assim seria vulnerável a uma vacina criada para combatê-lo.



    O sequenciamento também irá contribuir para a produção da vacina contra a gripe e avaliação da resposta dos doentes aos antivirais.



    Em São Paulo, o primeiro caso de infecção humana causada pela nova estirpe do vírus foi identificado em um homem de 26 anos que apresentou os sintomas da gripe ao retornar de uma viagem ao México.



    O paciente foi internado em 24 de abril no Instituto de Infectologia Emílio Ribas e recuperou-se. Amostra de secreção respiratória deste paciente foi investigada pelos pesquisadores do Adolfo Lutz, que depois isolaram o vírus. Como esse vírus veio importado do México, ainda não é possível dizer se ele será a forma predominante da doença no Brasil.



    Em boletim emitido na tarde de segunda-feira, 15, o Ministério da Saúde do Brasil confirmava 74 casos no País, a maioria concentrada nos Estados de São Paulo, Santa Catarina e Rio de Janeiro.



    O total de casos confirmados da doença no mundo é de pelo menos 37 mil, de acordo com a Organização Mundial da Saúde (OMS) e agências internacionais. Desde que surgiu no México, em abril deste ano, a doença matou pelo menos 163 pessoas, a maioria na América do Norte.



    (com Alexandre Gonçalves, de O Estado de S. Paulo)

    Fonte: http://www.estadao.com.br/noticias/v...a,388181,0.htm

    Comment


    • #3
      Re: A/São Paulo/H1N1 - mutation on Hemaglutinina

      http://www.google.com/hostednews/afp...NAik9vzooON1FA

      Brazil finds new strain of H1N1 virus

      25 minutes ago

      SAO PAULO (AFP) — Brazilian scientists have identified a new strain of the H1N1 virus after examining samples from a patient in Sao Paulo, their institute said Tuesday.

      The variant has been called A/Sao Paulo/1454/H1N1 by the Adolfo Lutz Bacteriological Institute, which compared it with samples of the A(H1N1) swine flu from California.

      The genetic sequence of the new sub-type of the H1N1 virus was isolated by a virology team lead by one of its researchers, Terezinha Maria de Paiva, the institute said in a statement.

      The mutation comprised of alterations in the Hemagglutinin protein which allows the virus to infect new hosts, it said.

      It was not yet known whether the new strain was more aggressive than the current A(H1N1) virus which has been declared pandemic by the World Health Organization.

      The genetic make-up of the H1N1 virus and its subvariants are important for scientists.

      Pharmaceutical companies are working to mass produce a vaccine against the current A(H1N1) flu.

      There are fears though that it could mutate into a deadly strain, much in the same way as the 1918 Spanish flu -- also an A(H1N1) virus type -- did when it killed tens of millions around the planet.

      According to the WHO, 36,000 people in 76 countries have been infected with the H1N1 virus, causing 163 deaths

      Comment


      • #4
        Re: A/São Paulo/H1N1 - mutation on Hemaglutinina

        just C1408T.
        Could be the Mexico-City substrain formerly called Korea-strain

        segments 5 and/or 6 are needed
        I'm interested in expert panflu damage estimates
        my current links: [url]http://bit.ly/hFI7H[/url] ILI-charts: [url]http://bit.ly/CcRgT[/url]

        Comment


        • #5
          Re: A/São Paulo/H1N1 - mutation on Hemaglutinina

          Originally posted by gsgs View Post
          just C1408T.
          Could be the Mexico-City substrain formerly called Korea-strain

          segments 5 and/or 6 are needed
          From PFI:

          Originally posted by AtomicVirus
          here it is again:
          http://www.google.com/hostednews/afp...NAik9vzooON1FA
          Brazil finds new strain of H1N1 virus
          SAO PAULO (AFP) — Brazilian scientists have identified a new strain of the H1N1 virus after examining samples from a patient in Sao Paulo, their institute said Tuesday.
          The variant has been called A/Sao Paulo/1454/H1N1 by the Adolfo Lutz Bacteriological Institute, which compared it with samples of the A(H1N1) swine flu from California.
          The genetic sequence of the new sub-type of the H1N1 virus was isolated by a virology team lead by one of its researchers, Terezinha Maria de Paiva, the institute said in a statement.
          The mutation comprised of alterations in the Hemagglutinin protein which allows the virus to infect new hosts, it said.
          It was not yet known whether the new strain was more aggressive than the current A(H1N1) virus which has been declared pandemic by the World Health Organization.
          The genetic make-up of the H1N1 virus and its subvariants are important for scientists.
          Pharmaceutical companies are working to mass produce a vaccine against the current A(H1N1) flu.
          There are fears though that it could mutate into a deadly strain, much in the same way as the 1918 Spanish flu -- also an A(H1N1) virus type -- did when it killed tens of millions around the planet.
          Brazil submitted the HA gene to NCBI on June 8, and the MP Gene on June 9.
          HA = GQ247724
          MP = GQ250156
          I bet there are a few folks on "SEQUENCES" who will eat this release up!

          Comment


          • #6
            Re: A/São Paulo/H1N1 - mutation on Hemaglutinina

            GenBank: GQ247724.1
            Influenza A virus (A/Sao Paulo/1454/2009(H1N1)) segment 4 hemagglutin (HA) gene, complete cds

            <input name="EntrezSystem2.PEntrez.Sequence.Sequence_Sing leReportPanel.Sequence_ViewerPanel.Sequence_Viewer Title.Database" sid="1" id="Database" value="nuccore" type="hidden">
            <script type="text/javascript" src="http://www.ncbi.nlm.nih.gov/core/ajax_loader/1.0/js/loadingbar.js"></script><script type="text/javascript" src="http://www.ncbi.nlm.nih.gov/core/ajax_loader/1.0/js/contentLoader.js"></script><link type="text/css" rel="stylesheet" href="http://www.ncbi.nlm.nih.gov/core/ajax_loader/1.0/css/loadingbar.css">

            LOCUS GQ247724 1701 bp cRNA linear VRL 08-JUN-2009
            DEFINITION Influenza A virus (A/Sao Paulo/1454/2009(H1N1)) segment 4
            hemagglutin (HA) gene, complete cds.
            ACCESSION GQ247724
            VERSION GQ247724.1 GI:239504533
            DBLINK Project:37813
            KEYWORDS .
            SOURCE Influenza A virus (A/Sao Paulo/1454/2009(H1N1))
            ORGANISM Influenza A virus (A/Sao Paulo/1454/2009(H1N1))
            Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
            Influenzavirus A.
            REFERENCE 1 (bases 1 to 1701)
            AUTHORS de Paiva,T.M., Santos,C.S., Silva,D.B., Correa,K.O., Ishida,M.A.,
            Benega,M.A. and Sacchi,C.
            TITLE Human infection with novel swine H1N1 influenza virus in Sao Paulo,
            Brazil
            JOURNAL Unpublished
            REFERENCE 2 (bases 1 to 1701)
            AUTHORS de Paiva,T.M., Santos,C.S., Silva,D.B., Correa,K.O., Ishida,M.A.,
            Benega,M.A. and Sacchi,C.
            TITLE Direct Submission
            JOURNAL Submitted (05-JUN-2009) Respiratory Virus Section, Adolfo Lutz
            Institute, Av. Dr. Arnaldo 355, Sao Paulo, SP 01246/902, Brazil
            COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
            outbreak of 2009.
            FEATURES Location/Qualifiers
            source 1..1701
            /organism="Influenza A virus (A/Sao
            Paulo/1454/2009(H1N1))"
            /mol_type="viral cRNA"
            /strain="A/Sao Paulo/1454/2009"
            /serotype="H1N1"
            /isolation_source="nasal swab"
            /host="Homo sapiens; gender M; age 26"
            /db_xref="taxon:650343"
            /segment="4"
            /country="Brazil"
            /collection_date="29-Apr-2009"
            /note="lineage: swl
            first MDCK cell passage"
            gene 1..1701
            /gene="HA"
            CDS 1..1701
            /gene="HA"
            /codon_start=1
            /product="hemagglutin"
            /protein_id="ACR78585.1"
            /db_xref="GI:239504534"
            /translation="MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVL EKNVTVT
            HSVNLLEDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWS YIVETSSS
            DNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAA CPHAGAKS
            FYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQ NADAYVFV
            GSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVP RYAFAMER
            NAGSGIIISDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKS TKLRLATG
            LRNVPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKS TQNAIDEI
            TNKVNSVIEKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAEL LVLLENER
            TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGT YDYPKYSE
            EAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAISFWMCSNG SLQCRICI"
            ORIGIN
            1 atgaaggcaa tactagtagt tctgctatat acatttgcaa ccgcaaatgc agacacatta
            61 tgtataggtt atcatgcgaa caattcaaca gacactgtag acacagtact agaaaagaat
            121 gtaacagtaa cacactctgt taaccttcta gaagacaagc ataacgggaa actatgcaaa
            181 ctaagagggg tagccccatt gcatttgggt aaatgtaaca ttgctggctg gatcctggga
            241 aatccagagt gtgaatcact ctccacagca agctcatggt cctacattgt ggaaacatct
            301 agttcagaca atggaacgtg ttacccagga gatttcatcg attatgagga gctaagagag
            361 caattgagct cagtgtcatc atttgaaagg tttgagatat tccccaagac aagttcatgg
            421 cccaatcatg actcgaacaa aggtgtaacg gcagcatgtc ctcatgctgg agcaaaaagc
            481 ttctacaaaa atttaatatg gctagttaaa aaaggaaatt catacccaaa gctcagcaaa
            541 tcctacatta atgataaagg gaaagaagtc ctcgtgctat ggggcattca ccatccatct
            601 actagtgctg accaacaaag tctctatcag aatgcagatg catatgtttt tgtggggtca
            661 tcaagataca gcaagaagtt caagccggaa atagcaataa gacccaaagt gagggatcaa
            721 gaagggagaa tgaactatta ctggacacta gtagagccgg gagacaaaat aacattcgaa
            781 gcaactggaa atctagtggt accgagatat gcattcgcaa tggaaagaaa tgctggatct
            841 ggtattatca tttcagatac accagtccac gattgcaata caacttgtca gacacccaag
            901 ggtgctataa acaccagcct cccatttcag aatatacatc cgatcacaat tggaaaatgt
            961 ccaaaatatg taaaaagcac aaaattgaga ctggccacag gattgaggaa tgtcccgtct
            1021 attcaatcta gaggcctatt tggggccatt gccggtttca ttgaaggggg gtggacaggg
            1081 atggtagatg gatggtacgg ttatcaccat caaaatgagc aggggtcagg atatgcagcc
            1141 gacctgaaga gcacacagaa tgccattgac gagattacta acaaagtaaa ttctgttatt
            1201 gaaaagatga atacacagtt cacagcagta ggtaaagagt tcaaccacct ggaaaaaaga
            1261 atagagaatt taaataaaaa agttgatgat ggtttcctgg acatttggac ttacaatgcc
            1321 gaactgttgg ttctattgga aaatgaaaga actttggact accacgattc aaatgtgaag
            1381 aacttatatg aaaaggtaag aagccagtta aaaaacaatg ccaaggaaat tggaaacggc
            1441 tgctttgaat tttaccacaa atgcgataac acgtgcatgg aaagtgtcaa aaatgggact
            1501 tatgactacc caaaatactc agaggaagca aaattaaaca gagaagaaat agatggggta
            1561 aagctggaat caacaaggat ttaccagatt ttggcgatct attcaactgt cgccagttca
            1621 ttggtactgg tagtctccct gggggcaatc agtttctgga tgtgctctaa tgggtctcta
            1681 cagtgtagaa tatgtattta a

            -
            http://www.ncbi.nlm.nih.gov/nuccore/...uence_RVDocSum
            -----
            //</pre>

            Comment


            • #7
              Re: A/São Paulo/H1N1 - mutation on Hemaglutinina

              *WARNING GOOGLE TRANSLATION*

              TECHNICAL NOTE

              Human cases of respiratory infection caused by a new type of influenza virus A, subtype H1N1 were of porcine origin reported by the Center for Disease Control and Prevention from 21 April 2009. So far, the disease was detected in 73 countries, with 25.3 thousand confirmed cases, 139 of them fatal. The new virus presents a unique combination of gene segments that in the past had been reported between the influenza virus from swine or human origin.

              In São Paulo, the first case of human infection caused by the new strain was identified in a man of 26 years who presented the symptoms of flu to return from a trip to Mexico. The patient was hospitalized on April 24 at the Institute of Infectious Diseases Emilio Ribas and is fully recovered.

              Respiratory secretion sample of this patient was subjected to molecular rt PCR methodology (§ reaà the polymerase chain in real time) with probe specific for the new subtype H1N1 by the team of molecular biologist Claudio Sacchi, and the result for the new viral subtype .

              Following the research the team of virology Terezinha Maria de Paiva, the Institute Adolfo Lutz, São Paulo, isolated at the end of April that the new strain is now known as A / Paulo/1454/H1N1 are following the rules of the World Health Organization . The virus isolation was performed in cell culture using the MDCK cells successfully in the first passage. In section electron microscopy of the Adolfo Lutz, Marli Ueda and Jonas Kisielius identified several virus particles from the infected culture. also the first observation.

              The isolation of the virus provided the sequence of the genetic material of the Brazilian strain, experiments being performed by Dr. Cecília Luiza Simões dos Santos of the Instituto Adolfo Lutz.

              The initial molecular characterization of strain A / Paulo/1454/H1N1 are involved the determination of complete sequences of two gene segments, segment 4, which encodes a protein Hemaglutina (HA) responsible for viral infectivity and for which antibodies are produced protectors, and segment 7, which encodes the matrix protein (MP) M1 and M2. The complete sequences of the genes HA and HB, the first determined for strains isolated in Brazil, are available in GenBank, a database that U.S. shared sequences obtained worldwide, which can be consulted by their respective numbers of access: GQ247724 (HA gene) and GQ250156 (MP gene). Molecular analysis indicated that while the virus segment 7 of A / Paulo/1454/H1N1 are shown to be completely conserved when compared to the reference strain A/Califórnia/04/H1N1, segment 4 showed a discrete number of nucleotide changes and of amino acids, with similar rates of around 99, 7% and 99.5% respectively. Detection of amantadine-resistance marker, comprising the amino acid asparagine (N) located at position 31 (N31) of the M2 protein in strain A / San Paulo/1454/H1N1, corroborates the literature that point be the new virus resistant to this class of antiviral compounds.

              The genetic characterization is essential in the investigation of molecular epidemiology of the virus to see if the viral pattern remains or has differed from those found in other world regions, contributing to the production of vaccine and evaluation of response to antivirals.

              Source: http://www.ial.sp.gov.br/

              ________________________________
              original in portuguese:

              NOTA TÉCNICA

              Casos humanos de infecção respiratória causada por um novo tipo de vírus da Influenza A, subtipo H1N1 de origem suína foram relatados pelo Center for Disease Control and Prevention a partir de 21 de Abril de 2009. Até o momento,a doença foi detectada em 73 países, com 25,3 mil casos confirmados,dos quais 139 fatais. O novo vírus apresenta uma combinação única de segmentos gênicos que nã o havia sido anteriormente relatada entre vírus da influenza de origem suína ou humana.

              Em São Paulo, o primeiro caso de infecção humana causada pela nova estirpe foi identificado em um homem de 26 anos que apresentou os sintomas da gripe ao retornar de uma viagem ao México. O paciente foi internado em 24 de abril no Instituto de Infectologia Emílio Ribas e recuperou-se plenamente.

              Amostra de secreção respiratória deste paciente foi submetida à metodologia molecular rt PCR (reação da polimerase em cadeia em tempo real) com sonda específica para o novo subtipo H1N1 pela equipe do biólogo molecular Claudio Sacchi; sendo o resultado positivo para o novo subtipo viral.

              Na sequência da investigação a equipe da virologista Terezinha Maria de Paiva, do Instituto Adolfo Lutz, em São Paulo isolou no final de abril a nova estirpe que passou a ser denominada A/São Paulo/1454/H1N1 segundo as normas da Organização Mundial da Saúde. O isolamento viral foi efetuado em cultivo celular utilizando-se as células MDCK com sucesso já na primeira passagem. Na seção de microscopia eletrônica do Adolfo Lutz, Marli Ueda e Jonas Kisielius identificaram várias partículas do vírus a partir da cultura infectada. também na primeira observação.

              O isolamento do vírus propiciou o sequenciamento do material genético da estirpe brasileira, experimentos que estão sendo efetuados pela Dra. Cecília Luiza Simões dos Santos do Instituto Adolfo Lutz.

              A caracterização molecular inicial da estirpe A/São Paulo/1454/H1N1 envolveu a determinação das sequências nucleotídicas completas de dois segmentos gênicos, o segmento 4, que codifica a proteína Hemaglutina (HA)responsável pela infectividade viral e para a qual são produzidos os anticorpos protetores; e o segmento 7, que codifica as proteínas da matriz (MP) M1 e M2. As sequências completas dos genes HA e MP, as primeiras determinadas para estirpes isoladas no Brasil, estão disponíveis no GenBank, banco de dados americano que compartilha sequências nucleotídicas obtidas mundialmente, que podem ser consultadas por seus respectivos números de acesso: GQ247724 (gene HA) e GQ250156 (gene MP). A análise molecular indicou que, enquanto o segmento 7 do vírus A/São Paulo/1454/H1N1 mostrou-se completamente conservado quando comparado ao da estirpe referencia A/Califórnia/04/H1N1, o segmento 4 apresentou um numero discreto de alterações nucleotídicas e de aminoácidos, com taxas de similaridade em torno de 99, 7 % e 99,5%, respectivamente. A detecção do marcador de resistência a amantadina, constituído pelo aminoácido asparagina (N) localizado na posição 31 (N31) da proteína M2, na estirpe A/São Paulo/1454/H1N1, corrobora os dados da literatura que apontam ser o novo vírus resistente a esta classe de compostos antivirais.

              A caracterização genética é fundamental na investigação da epidemiologia molecular do vírus para saber se o padrão viral se mantém ou já se diferenciou dos encontrados em outras regiões do mundo, contribuir para a produção de vacina e avaliação de resposta aos antivirais.

              Fonte: http://www.ial.sp.gov.br/

              Comment


              • #8
                Re: A/São Paulo/H1N1 - mutation on Hemaglutinina

                CA/04 should not reasonably considered the reference strain
                (it has 2 mutations already)
                although used in the US-vaccine

                then comes the 3rd difference from the Mex-strain, but in HA2,
                so antigenically irrelevant
                I'm interested in expert panflu damage estimates
                my current links: [url]http://bit.ly/hFI7H[/url] ILI-charts: [url]http://bit.ly/CcRgT[/url]

                Comment

                Working...
                X