Announcement

Collapse
No announcement yet.

H1N1 Swine Flu - Thailand

Collapse
X
  • Filter
  • Time
  • Show
Clear All
new posts

  • H1N1 Swine Flu - Thailand

    LOCUS GQ132184 284 bp cRNA linear VRL 09-MAY-2009
    DEFINITION Influenza A virus (A/Nonthaburi/102/2009(H1N1)) segment 4
    hemagglutinin (HA) gene, partial cds.
    ACCESSION GQ132184
    VERSION GQ132184.1 GI:229892685
    DBLINK Project:37813
    KEYWORDS .
    SOURCE Influenza A virus (A/Nonthaburi/102/2009(H1N1))
    ORGANISM Influenza A virus (A/Nonthaburi/102/2009(H1N1))
    Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
    Influenzavirus A.
    REFERENCE 1 (bases 1 to 284)
    AUTHORS de Silva,J.W., Lukebua,A., Waicharoen,S. and Chitakanpitch,M.
    TITLE First 2009 H1N1 Influenza (Swine Flu) Isolate from Thailand
    JOURNAL Unpublished
    REFERENCE 2 (bases 1 to 284)
    AUTHORS de Silva,J.W., Lukebua,A., Waicharoen,S. and Chitakanpitch,M.
    TITLE Direct Submission
    JOURNAL Submitted (09-MAY-2009) National Influenza Center, Department of
    Medical Sciences, 88/7 Ministry of Public Health Tiwanon Rd.,
    Muang, Nonthaburi 11000, Thailand
    COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
    outbreak of 2009.
    FEATURES Location/Qualifiers
    source 1..284
    /organism="Influenza A virus
    (A/Nonthaburi/102/2009(H1N1))"
    /mol_type="viral cRNA"
    /strain="A/Nonthaburi/102/2009"
    /serotype="H1N1"
    /host="Homo sapiens"
    /db_xref="taxon:644373"
    /segment="4"
    /country="Thailand"
    /collection_date="2009"
    /note="passaged in MDCK cells"
    gene <1..>284
    /gene="HA"
    CDS <1..>284
    /gene="HA"
    /codon_start=2
    /product="hemagglutinin"
    /protein_id="ACQ89893.1"
    /db_xref="GI:229892686"
    /translation="SSDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKC PKYVKST
    KLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSG "
    ORIGIN
    1 cagttcagat acaccagtcc acgattgcaa tacaacttgt cagacaccca agggtgctat
    61 aaacaccagc ctcccatttc agaatataca tccgatcaca attggaaaat gtccaaaata
    121 tgtaaaaagc acaaaattga gactggccac aggattgagg aatgtcccgt ctattcaatc
    181 tagaggccta tttggggcca ttgccggttt cattgaaggg gggtggacag ggatggtaga
    241 tggatggtac ggttatcacc atcaaaatga gcaggggtca ggat

  • #2
    Re: H1N1 Swine Flu - Thailand

    Top 100 matches

    gb|GQ132184.1| Influenza A virus (A/Nonthaburi/102/2009(H1N1)... 513 2e-142
    gb|GQ132147.1| Influenza A virus (A/Canada-NS/RV1536/2009(H1N... 508 8e-141
    gb|GQ132146.1| Influenza A virus (A/Canada-AB/RV1532/2009(H1N... 508 8e-141
    gb|GQ132145.1| Influenza A virus (A/Mexico/InDRE4114/2009(H1N... 508 8e-141
    gb|GQ132144.1| Influenza A virus (A/Canada-ON/RV1529/2009(H1N... 508 8e-141
    gb|GQ132143.1| Influenza A virus (A/Canada-ON/RV1526/2009(H1N... 508 8e-141
    gb|GQ132142.1| Influenza A virus (A/Canada-NS/RV1538/2009(H1N... 508 8e-141
    gb|CY039893.1| Influenza A Virus (A/New York/1669/2009(H1N1))... 508 8e-141
    gb|GQ131023.1| Influenza A virus (A/Korea/01/2009(H1N1)) segm... 508 8e-141
    gb|GQ122102.1| Influenza A virus (A/Catalonia/P154/2009(H1N1)... 508 8e-141
    gb|GQ122097.1| Influenza A virus (A/Texas/15/2009(H1N1)) segm... 508 8e-141
    gb|GQ117100.2| Influenza A virus (A/Ohio/07/2009(H1N1)) segme... 508 8e-141
    gb|GQ117116.1| Influenza A virus (A/New York/13/2009(H1N1)) s... 508 8e-141
    gb|GQ117112.1| Influenza A virus (A/Michigan/02/2009(H1N1)) s... 508 8e-141
    gb|GQ117103.1| Influenza A virus (A/Massachusetts/07/2009(H1N... 508 8e-141
    gb|GQ117097.1| Influenza A virus (A/Indiana/09/2009(H1N1)) se... 508 8e-141
    gb|GQ117086.1| Influenza A virus (A/New York/20/2009(H1N1)) s... 508 8e-141
    gb|GQ117082.1| Influenza A virus (A/New York/20/2009(H1N1)) s... 508 8e-141
    gb|GQ117079.1| Influenza A virus (A/Arizona/02/2009(H1N1)) se... 508 8e-141
    gb|GQ117067.1| Influenza A virus (A/Arizona/01/2009(H1N1)) se... 508 8e-141
    gb|GQ117062.1| Influenza A virus (A/Kansas/03/2009(H1N1)) seg... 508 8e-141
    gb|GQ117059.1| Influenza A virus (A/Kansas/02/2009(H1N1)) seg... 508 8e-141
    gb|GQ117051.1| Influenza A virus (A/Texas/08/2009(H1N1)) segm... 508 8e-141
    gb|GQ117043.1| Influenza A virus (A/Massachusetts/06/2009(H1N... 508 8e-141
    gb|GQ117040.1| Influenza A virus (A/California/14/2009(H1N1))... 508 8e-141
    gb|GQ117032.1| Influenza A virus (A/Texas/09/2009(H1N1)) segm... 508 8e-141
    gb|GQ117024.1| Influenza A virus (A/New York/22/2009(H1N1)) s... 508 8e-141
    gb|FJ998209.1| Influenza A virus (A/Canada-ON/RV1527/2009(H1N... 508 8e-141
    gb|FJ998208.1| Influenza A virus (A/Mexico/InDRE4487/2009(H1N... 508 8e-141
    gb|FJ998207.1| Influenza A virus (A/Canada-NS/RV1535/2009(H1N... 508 8e-141
    gb|FJ984401.1| Influenza A virus (A/Ohio/07/2009(H1N1)) segme... 508 8e-141
    gb|FJ984397.1| Influenza A virus (A/Ohio/07/2009(H1N1)) segme... 508 8e-141
    gb|FJ984394.1| Influenza A virus (A/New York/19/2009(H1N1)) s... 508 8e-141
    gb|FJ984385.1| Influenza A virus (A/Texas/06/2009(H1N1)) segm... 508 8e-141
    gb|FJ984375.1| Influenza A virus (A/New York/10/2009(H1N1)) s... 508 8e-141
    gb|FJ984364.1| Influenza A virus (A/New York/23/2009(H1N1)) s... 508 8e-141
    gb|FJ984360.1| Influenza A virus (A/New York/31/2009(H1N1)) s... 508 8e-141
    gb|FJ984355.1| Influenza A virus (A/New York/18/2009(H1N1)) s... 508 8e-141
    gb|FJ984347.1| Influenza A virus (A/New York/11/2009(H1N1)) s... 508 8e-141
    gb|FJ984337.1| Influenza A virus (A/New York/12/2009(H1N1)) s... 508 8e-141
    gb|FJ982430.1| Influenza A virus (A/Denmark/513/2009(H1N1)) s... 508 8e-141
    gb|FJ981615.1| Influenza A virus (A/Texas/04/2009(H1N1)) segm... 508 8e-141
    gb|FJ981612.1| Influenza A virus (A/Texas/04/2009(H1N1)) segm... 508 8e-141
    gb|CY039527.1| Influenza A virus (A/Netherlands/602/2009(H1N1... 508 8e-141
    gb|FJ974021.1| Influenza A virus (A/Regensburg/Germany/01/200... 508 8e-141
    gb|FJ973557.1| Influenza A virus (A/Auckland/1/2009(H1N1)) se... 508 8e-141
    gb|FJ969511.1| Influenza A virus (A/California/10/2009(H1N1))... 508 8e-141
    gb|FJ969509.1| Influenza A virus (A/New York/19/2009(H1N1)) s... 508 8e-141
    gb|FJ966982.1| Influenza A virus (A/Texas/04/2009(H1N1)) segm... 508 8e-141
    gb|FJ966960.1| Influenza A virus (A/California/06/2009(H1N1))... 508 8e-141
    gb|FJ966959.1| Influenza A virus (A/Texas/05/2009(H1N1)) segm... 508 8e-141
    gb|FJ966952.1| Influenza A virus (A/California/05/2009(H1N1))... 508 8e-141
    gb|CY039901.1| Influenza A Virus (A/New York/1682/2009(H1N1))... 504 1e-139
    gb|GQ122099.1| Influenza A virus (A/Catalonia/P148/2009(H1N1)... 504 1e-139
    gb|GQ122105.1| Influenza A virus (A/Stockholm/28/2009(H1N1)) ... 504 1e-139
    gb|GQ117119.1| Influenza A virus (A/Colorado/03/2009(H1N1)) s... 504 1e-139
    gb|GQ117091.1| Influenza A virus (A/Texas/07/2009(H1N1)) segm... 504 1e-139
    gb|GQ117056.1| Influenza A virus (A/South Carolina/09/2009(H1... 504 1e-139
    gb|GQ117044.1| Influenza A virus (A/California/04/2009(H1N1))... 499 4e-138
    gb|FJ981613.1| Influenza A virus (A/California/07/2009(H1N1))... 499 4e-138
    gb|FJ971076.1| Influenza A virus (A/California/08/2009(H1N1))... 499 4e-138
    gb|FJ969540.1| Influenza A virus (A/California/07/2009(H1N1))... 499 4e-138
    gb|FJ966974.1| Influenza A virus (A/California/07/2009(H1N1))... 499 4e-138
    gb|FJ966082.1| Influenza A virus (A/California/04/2009(H1N1))... 499 4e-138
    gb|EU139828.1| Influenza A virus (A/swine/Minnesota/1192/2001... 441 1e-120
    gb|EF556201.1| Influenza A virus (A/swine/Guangxi/17/2005(H1N... 441 1e-120
    gb|AF455680.1| Influenza A virus (A/Swine/Indiana/P12439/00 (... 435 4e-119
    gb|AY060034.1| Influenza A virus (A/SW/KS/13481-S/00(H1N2)) h... 432 5e-118
    gb|AY060033.1| Influenza A virus (A/SW/KS/13481-T/00(H1N2)) h... 432 5e-118
    gb|AY060032.1| Influenza A virus (A/SW/MN/13130/00(H1N2)) hem... 432 5e-118
    gb|AF455675.1| Influenza A virus (A/Swine/Ohio/891/01(H1N2)) ... 432 5e-118
    gb|AF250124.1|AF250124 Influenza A virus (A/Swine/Indiana/9K0... 432 5e-118
    gb|AY060045.1| Influenza A virus (A/SW/OH/7802/00(H1N2)) hema... 426 2e-116
    gb|AY060044.1| Influenza A virus (A/SW/NE/18339/01(H1N2)) hem... 426 2e-116
    gb|AY060039.1| Influenza A virus (A/SW/IN/14810-S/01(H1N2)) h... 426 2e-116
    gb|AY060038.1| Influenza A virus (A/SW/IN/14810-T/01(H1N2)) h... 426 2e-116
    gb|AY060031.1| Influenza A virus (A/SW/MN/12883/00(H1N2)) hem... 426 2e-116
    gb|AY060030.1| Influenza A virus (A/SW/AR/12491/00(H1N2)) hem... 426 2e-116
    gb|AY038014.1| Influenza A virus (A/Turkey/MO/24093/99(H1N2))... 426 2e-116
    gb|EF556199.1| Influenza A virus (A/swine/Guangxi/13/2006(H1N... 423 3e-115
    gb|AY060050.1| Influenza A virus (A/SW/MN/16419/01(H1N2)) hem... 423 3e-115
    gb|AF455681.1| Influenza A virus (A/Swine/Illinois/100085A/01... 423 3e-115
    gb|FJ986619.1| Influenza A virus (A/Wisconsin/87/2005(H1N1)) ... 417 1e-113
    gb|EU139830.1| Influenza A virus (A/swine/Minnesota/00194/200... 417 1e-113
    gb|AY060049.1| Influenza A virus (A/SW/MO/1877/01(H1N2)) hema... 417 1e-113
    gb|AY060048.1| Influenza A virus (A/SW/MN/23124-S/01(H1N2)) h... 417 1e-113
    gb|AY060047.1| Influenza A virus (A/SW/MN/23124-T/01(H1N2)) h... 417 1e-113
    gb|AF455679.1| Influenza A virus (A/Swine/Iowa/930/01(H1N2)) ... 417 1e-113
    gb|EU409955.1| Influenza A virus (A/swine/Ohio/75004/04(H1N1)... 416 4e-113
    gb|AY060046.1| Influenza A virus (A/SW/CO/17871/01(H1N2)) hem... 416 4e-113
    gb|EU139831.1| Influenza A virus (A/swine/Kansas/00246/2004(H... 414 1e-112
    gb|EU798784.1| Influenza A virus (A/swine/Korea/Asan04/2006(H... 410 2e-111
    gb|EU798783.1| Influenza A virus (A/swine/Korea/JL04/2005(H1N... 410 2e-111
    gb|EU798781.1| Influenza A virus (A/swine/Korea/JL01/2005(H1N... 410 2e-111
    gb|EU798782.1| Influenza A virus (A/swine/Korea/JL02/2005(H1N... 408 6e-111
    gb|EU409960.1| Influenza A virus (A/swine/Ohio/C62006/06(H1N1... 408 6e-111
    gb|DQ666933.1| Influenza A virus (A/swine/Korea/S11/2005(H1N2... 408 6e-111
    gb|AY129156.1| Influenza A virus (A/Swine/Korea/CY02/02(H1N2)... 408 6e-111
    gb|AF455682.1| Influenza A virus (A/Swine/Illinois/100084/01 ... 408 6e-111
    gb|AF455676.1| Influenza A virus (A/Swine/North Carolina/9822... 408 6e-111

    Comment


    • #3
      Re: H1N1 Swine Flu - Thailand

      New flu suspect confirmed in Thailand

      BANGKOK, May 9 (Xinhua) -- A suspect case of Influenza A/H1N1 has been detected in Thailand, Public Health permanent secretary Prat Boonyawongwiroj confirmed Saturday.

      He said the person has been healed from the illness and under quarantine for seven days, the TPBS reported.
      The Public Health Ministry has requested a test by a U.S. lab to confirm the finding, Prat said, without identifying the patient. He did not reveal how the patient arrived at Thailand, either.
      A two-day ASEAN Plus Three Health Ministers Special Meeting on Influenza A/H1N1 concluded on Friday in Bangkok after the countries involved agreed to establish a system for sharing of essential supplies among national stockpiles "in case of emergency needs" and to ensure prompt sharing of information by setting up hotlines among national health authorities. Clusters of A/H1N1 flu outbreaks have appeared in multiple locations in Mexico, the United States and then across the world, taking the death toll of 46 since the first infection case was reported on 17 March. According to the update from WHO, at least 2,500 confirmed cases have been found in 25 countries and areas globallyhttp://news.xinhuanet.com/english/2009-05/09/content_11342506.htm.

      Comment


      • #4
        Re: H1N1 Swine Flu - Thailand

        Well that sequence is interesting - and clearly speaks to the 99.99% similarity issues/debate floating around of late.

        Comment


        • #5
          Re: H1N1 Swine Flu - Thailand

          Originally posted by Extrapolation View Post
          Well that sequence is interesting - and clearly speaks to the 99.99% similarity issues/debate floating around of late.
          As well as the lies about a lack of lab confirmation of swine h1N1 in Thailand.

          Comment

          Working...
          X