Announcement

Collapse
No announcement yet.

H3n2

Collapse
X
  • Filter
  • Time
  • Show
Clear All
new posts

  • #16
    Re: H3n2

    H3 in Denmark had seven mutations at key antigenic sites
    http://www.cidrap.umn.edu/cidrap/con...13fluscan.html

    http://www.eurosurveillance.org/View...rticleId=20397
    Based on HA amino acid sequence analysis, the Danish A(H3N2) viruses formed two main clades,
    A and B (Figure 2).
    Clade B is within the defined 3C A(H3) phylogenetic clade, where the 2012/13 A(H3N2)
    vaccine component (A/Victoria/361/2011) is assigned,
    but the Danish clade A should probably be assigned a new A(H3) clade. Five of the 22
    Danish HA sequences included in the phylogenetic analysis, collected from week 46
    (11 December 2012) to week 1 (2 January 2013), were from patients who had been
    vaccinated before week 47: all five were located in clade A (Figure 2).

    Altogether, seven amino acid substitutions in the HA defined the Danish clade A,
    compared with egg-grown/tissue grown A/Victoria/361/2011 –
    T128A, R/Q156H,V186G;R142G,N145S;N278K;S/Y219S.
    Additional substitutions were Q33R, E/D190D and V347M.

    The clade B viruses did not possess the substitutions at positions 128, 142 and 347.

    The clade A viruses have lost the 126 N-linked glycosylation seen in A/Victoria/361/2011
    and clade B (predicted by NetNGlyc 1.0 server [7]. For comparison, we included reference
    HA sequences from influenza A(H3) viruses, obtained from the EpiFlu database of the
    Global Initiative on Sharing Avian Influenza Data (GISAID) (Table 3).

    =================================================0

    DK-A = Quebec (Q49R,S61N,T64I,T144A,R158G,N161S,A214S,V239I,N294 K,N328S,V363M)

    DK-B = Alberta (Q49R,S61N,T64I,N161S,A214S,V239I,N294K,N328S)

    [as compared to Egypt/Iowa/2009]

    while the vax-strain A/Victoria/361/2011 seems to have the additional mutations
    H172RorQ,G202V,S235SorY,D190EorD

    ---------------------------------------------------------
    6 H3-HAs from USA today at genbank
    5 (3CA+2IL) are DK-B=ALB
    1 (CA) is DK-A = Quebec
    ---------------------------------------------------------------
    I'm interested in expert panflu damage estimates
    my current links: [url]http://bit.ly/hFI7H[/url] ILI-charts: [url]http://bit.ly/CcRgT[/url]

    Comment


    • #17
      Re: H3n2




      rooted to Egypt/Iowa:

      http://www.flutrackers.com/forum/att...1&d=1361961785

      (looks as if I should redefine the 2011-normal-index ?!)
      Attached Files
      I'm interested in expert panflu damage estimates
      my current links: [url]http://bit.ly/hFI7H[/url] ILI-charts: [url]http://bit.ly/CcRgT[/url]

      Comment


      • #18
        Re: H3n2

        lots of new sequences today at genbank


        here are all human H3N2s since Sept.2012



        you can immediately spot one reassortment at the 2 black bars on the right,
        where the sequences are similar in HA but different in MP,PB2,PA

        --------well, that's the old reassortment from 2011, both are still there and evolved in the meantime.

        53 full genomes from Texas ("JMM") , 4 groups and 2-3 minor overlaps by exchanging(reassorting) segments
        1.) 28 of them are similar to the Czech/121 virus from last season
        4.) 8 of them are the 2011-reassorted virus
        3.) 12 of them are a strain, that I don't know yet where it comes from, different from the other
        3 strains circulating in Texas, but probably still a descendent from Egypt/Iowa/2009
        2.) 4 are reassorted, getting segments 24568 from group 1.) and 137 from an ancester of group 3.)

        Attached Files
        I'm interested in expert panflu damage estimates
        my current links: [url]http://bit.ly/hFI7H[/url] ILI-charts: [url]http://bit.ly/CcRgT[/url]

        Comment


        • #19
          Re: H3n2

          so, do the sequences give us hints, why this season was so bad in USA ?
          Not really. I'm not sure.
          And we have a severe season in Europe too, but with other strains.

          -----------------------------------------------------------------------------------------------
          the first appearance of the Czech/121 strain "1.)" , 28 out of 53 in Texas
          and 75 out of 82 in Canada, was in many Singapore isolates from mid 2011
          first: A/Singapore/TT430/2011/07/29
          --------------------------------------------------------------------------------------------------------
          the first appearance of the additional HA-mutations that are in the new reassorted
          strain "2.)", in 4 out of 53 recent Texas genomes
          - -not seen before
          ---------------------------------------------------------------------------------------------------------------
          the first appearance of the new 3.) strain ,12 out of 53 in Texas, was in
          A/Pavia/131/2012/02/21
          A/St.Petersburg/RII25/2012/02/23
          A/Ekaterinburg/RII3/2012/02/29

          ------------------------------------------------------------------------------------------------------------------
          the first appearance of that "reassorted-2011" strain, "2.)", now seen in 8 out of 53 of the
          Texas-JMM-genomes and in 7 out of 82 recent HAs from Canada
          was in A/Pennsylvania/02/2010/02/21 , which is now public.

          http://www.ncbi.nlm.nih.gov/nuccore/KC535475
          It was passaged 2010/02/21, but colleced 2010/01/07.
          H3N2 was very rare in 2009/2010, but indeed there was
          one H3 from week 2 in region 3:
          http://www.cdc.gov/flu/weekly/region...a/whoreg3t.htm
          And this sequence had been mentioned on the web already in Sept.2010.

          2010 is surprisingly early for that new strain, which was one of the dominating H3 strains
          the season later, and surprising is also that it first appeared in USA.
          It would be interesting to see the travel history of that 74 year old male
          from Pennsylvania. Was he in Asia over Christmas ? Maybe that was the reason why he
          was sampled in the first place.
          The next appearance was in Netherlands,April,2010.
          ------------------------------------------------------------------------------------------------------------------
          I'm interested in expert panflu damage estimates
          my current links: [url]http://bit.ly/hFI7H[/url] ILI-charts: [url]http://bit.ly/CcRgT[/url]

          Comment


          • #20
            Re: H3n2

            HA and NA from Japan,Hokkaido,2013 have been published.
            It is very similar to the Texas genomes from Nov.
            e.g. JMM_22
            I'm interested in expert panflu damage estimates
            my current links: [url]http://bit.ly/hFI7H[/url] ILI-charts: [url]http://bit.ly/CcRgT[/url]

            Comment


            • #21
              Re: H3n2

              H3N2 in USA season 2011/2012

              ---------------------------------------

              there are 3 sorts of human H3N2-HAs since July 2012 :
              ~75% is the Czech/121 strain , ~20 the reassorted/2011 strain, ~5% the new Texas strain
              Attached Files
              I'm interested in expert panflu damage estimates
              my current links: [url]http://bit.ly/hFI7H[/url] ILI-charts: [url]http://bit.ly/CcRgT[/url]

              Comment


              • #22
                Re: H3n2

                HAs from India, summer 2013, have nucleotide mutations:
                A430G,A472G,(T518C),G1087A,G1080A
                giving amino-acid mutations T144A,R158G,(L173S),V363K



                Code:
                                                                                    000000000000000000000000000000000000000000000000000000000000000000000111111111111111111111111111 
                                                                                    000000111111222222223333444444444555555556666666667777778888889999999000000111112233444555555556 
                                                                                    034577048999012344891122135778888012445690011468891223693378891225678004588338995945124001244677 
                                                                                    998202862016598203516838906280234182369546925002705696590732735344653597378015574643683798458081 
                -codon-position-----------------------------------------------------   11  221211  1    1 2121 11 2 1 2   11     1 1  1  1 12   22 2    2 1  122  1        1         
                ---Index------------------------------------------------------------TGTAACAAGACGGGTGCACTCCATGACAATACAGTACGAATTGCTGCAACGCCAGCGGCTATCAACCTAGCCCGTTAGAGCCGTGGTGCAAGCCAA 
                   1 >Index/USA-2007                                                ................................................................................................        0      0 ,      0      0       1:>Index/USA-2007                                                
                   2 >Index/Perth-like/2009                                         ...............A.............A.....C...C....A.......T......................G...A.T..........TAG.       12     12 ,     12     12       2:>Index/Perth-like/2009                                         
                   3 >Index/2009/Egypt/Iowa                                         .....................A.........T...C...C....G.AG....T................A..A..G...A.T...........AG.       15     15 ,     15     15       3:>Index/2009/Egypt/Iowa                                         
                   4 >Index/H3N3-2011-reassortedEI/2011(H3N2)                       ......G.....A......C.A.C.......T...C...C....G.AG.T..TG......C........AA.A..GG..A.T.C.....G.A.AG.       27     27 ,     27     27       4:>Index/H3N3-2011-reassortedEI/2011(H3N2)                       
                   5 >Index/H3N2-2011-normalEI/2011(H3N2)                           C........G...T.......AG........T...C...C....G.AG....T...............GA..AA.G.A.A.T...........AG.       22     22 ,     22     22       5:>Index/H3N2-2011-normalEI/2011(H3N2)                           
                   6 >Index/2009/Egypt-Iowa+NA,2009//                               .....................A.........T...C...C....G.AG....T................A..A..G...A.T...........AG.       15     15 ,     15     15       6:>Index/2009/Egypt-Iowa+NA,2009//                               
                   7 >A/Czech Republic/121/2012,2012/03/06,Czech Republic           .....T.GA.TA..C......A..A.T....T.A.C..GC....GTAG..ATT......G........GA..A..G..CAAT...........AGG       33     33 ,     33     33       7:>A/Czech Republic/121/2012,2012/03/06,Czech Republic           
                   8 >Index/32g12f1.c2,10-37                                        .....T.GA.T.....T.T..A....T...GT.A.C...C....GTAG..A.T.A....G..A.....GA..A..G..CAAT........G..AGG       34     34 ,     34     34       8:>Index/32g12f1.c2,10-37                                        
                   9 >Index/32g12f1.c2,38-41                                        .....T.GA.T..A...GT..A..A.T...GT.A.C...C.CA.GTAG..A.T......G...G....GA..A..G..CAAT.......GG..AGG       38     38 ,     38     38       9:>Index/32g12f1.c2,38-41                                        
                  10 >Index/32g12f1.c2,42-53                                        .AC..................A......G.GT...C...C....G.ATG.A.T...A.A.......T..A..A..G...A.TA.AACA.....AG.       29     29 ,     29     29      10:>Index/32g12f1.c2,42-53                                        
                  11 >Index/32g12f1.c2,55-62                                        CA.GG.GG....A......CAA.C.......T...C...C....G.A..T..TGA..A..C......C.AATA..GG..A.T.C....TG.A.AG.       37     37 ,     37     37      11:>Index/32g12f1.c2,55-62                                        
                  12 >KF668185,A/India/LKO799/2011,2011/07/16,India,H3N2,Human,4    ------------------------......GT...C...C....GTAG..A.T...............GA..A..---------------------       58     58 ,     13     13      12:>KF668185,A/India/LKO799/2011,2011/07/16,India,H3N2,Human,4    
                  13 >KF668186,A/India/LKO827/2011,2011/07/25,India,H3N2,Human,4    -------------------------.....GT...CT..CC...GTAG..A.T........C......GA..A-----------------------       64     64 ,     16     16      13:>KF668186,A/India/LKO827/2011,2011/07/25,India,H3N2,Human,4    
                  14 >KF668187,A/India/LKO845/2011,2011/07/26,India,H3N2,Human,4    ------------------------......GT...C...C....GTAG..A.T...............GA..A-----------------------       60     60 ,     13     13      14:>KF668187,A/India/LKO845/2011,2011/07/26,India,H3N2,Human,4    
                  15 >KF668188,A/India/LKO851/2011,2011/07/27,India,H3N2,Human,4    ------------------------......GT...C...C....GTAG..A.T...............GA..A-----------------------       60     60 ,     13     13      15:>KF668188,A/India/LKO851/2011,2011/07/27,India,H3N2,Human,4    
                  16 >KF668189,A/India/LKO856/2011,2011/07/28,India,H3N2,Human,4    ------------------------......GT...C...C....GTAG..A.T...............GA..A..---------------------       58     58 ,     13     13      16:>KF668189,A/India/LKO856/2011,2011/07/28,India,H3N2,Human,4    
                  17 >KF668190,A/India/LKO871/2011,2011/07/29,India,H3N2,Human,4    ------------------------......GT...C...C....GTAG..A.T...............GA..A-----------------------       60     60 ,     13     13      17:>KF668190,A/India/LKO871/2011,2011/07/29,India,H3N2,Human,4    
                  18 >KF668191,A/India/LKO896/2011,2011/08/03,India,H3N2,Human,4    ------------------------......GT...C...C....GTAG..A.T...A...........GA..A-----------------------       61     61 ,     14     14      18:>KF668191,A/India/LKO896/2011,2011/08/03,India,H3N2,Human,4    
                  19 >KF668192,A/India/LKO983/2011,2011/08/25,India,H3N2,Human,4    ------------------------......GT...C...C....GTAG..A.T...............GA..A-----------------------       60     60 ,     13     13      19:>KF668192,A/India/LKO983/2011,2011/08/25,India,H3N2,Human,4    
                  20 >KF668193,A/India/LKO1442/2012,2012/01/23,India,H3N2,Human,4   ------------------------......GT...C...C....GTAG..A.T...............GA..A..---------------------       58     58 ,     13     13      20:>KF668193,A/India/LKO1442/2012,2012/01/23,India,H3N2,Human,4   
                  21 >KF668194,A/India/LKO1501/2012,2012/02/14,India,H3N2,Human,4   ------------------------......GT...C...C....GTAG..A.T...............GA..A-----------------------       60     60 ,     13     13      21:>KF668194,A/India/LKO1501/2012,2012/02/14,India,H3N2,Human,4   
                  22 >KF668195,A/India/LKO3108/2012,2012/12/12,India,H3N2,Human,4   ------------------------......GT...C...C....GTAG..A.T...............GA..A..---------------------       58     58 ,     13     13      22:>KF668195,A/India/LKO3108/2012,2012/12/12,India,H3N2,Human,4   
                  23 >KF668196,A/India/LKO3818/2013,2013/06/25,India,H3N2,Human,4   -------------------------GTG..GT.A.C.A.C....GTAG..A.T......G........GA..A-----------------------       67     67 ,     19     19      23:>KF668196,A/India/LKO3818/2013,2013/06/25,India,H3N2,Human,4   
                  24 >KF668197,A/India/LKO3824/2013,2013/06/26,India,H3N2,Human,4   ------------------------.GTG..GT.ACCT..C....GTAG..A.T......G....G...GA..A-----------------------       68     68 ,     21     21      24:>KF668197,A/India/LKO3824/2013,2013/06/26,India,H3N2,Human,4   
                  25 >KF668198,A/India/LKO3825/2013,2013/06/26,India,H3N2,Human,4   ------------------------.GTG..GT.ACC...C....GTAG..A.T......G........GA..A-----------------------       66     66 ,     19     19      25:>KF668198,A/India/LKO3825/2013,2013/06/26,India,H3N2,Human,4   
                  26 >KF668199,A/India/LKO3839/2013,2013/06/29,India,H3N2,Human,4   ------------------------.GTG..GT.ACC...C....GTAG..A.T......G........GA..A-----------------------       66     66 ,     19     19      26:>KF668199,A/India/LKO3839/2013,2013/06/29,India,H3N2,Human,4   
                  27 >KF668200,A/India/LKO3863/2013,2013/07/06,India,H3N2,Human,4   --------------------------TG..GT.A.C...C....GTAG..A.T......G........GA..A-----------------------       66     66 ,     17     17      27:>KF668200,A/India/LKO3863/2013,2013/07/06,India,H3N2,Human,4   
                  28 >KF668201,A/India/LKO3876/2013,2013/07/09,India,H3N2,Human,4   -------------------------GTG..GTGACC...C....GTAG..A.T......G........GA..A-----------------------       68     68 ,     20     20      28:>KF668201,A/India/LKO3876/2013,2013/07/09,India,H3N2,Human,4   
                  29 >KF668202,A/India/LKO3887/2013,2013/07/10,India,H3N2,Human,4   --------------------------TG..GT.A.C...C....GTAG..A.T......G.....T..GA..AAA---------------------       67     67 ,     20     20      29:>KF668202,A/India/LKO3887/2013,2013/07/10,India,H3N2,Human,4   
                  30 >KF668203,A/India/LKO3889/2013,2013/07/11,India,H3N2,Human,4   -------------------------GTG..GT.ACC...C....GTAG..A.T......G........GA..A-----------------------       67     67 ,     19     19      30:>KF668203,A/India/LKO3889/2013,2013/07/11,India,H3N2,Human,4   
                  31 >KF668204,A/India/LKO3893/2013,2013/07/12,India,H3N2,Human,4   -------------------------GTG..GT.A.C...C...TGTAG..A.T......G.....T..GA..A-----------------------       68     68 ,     20     20      31:>KF668204,A/India/LKO3893/2013,2013/07/12,India,H3N2,Human,4   
                  32 >KF668205,A/India/LKO3906/2013,2013/07/15,India,H3N2,Human,4   --------------------------TG..GT.ACC...C....GTAG..A.T......G........GA..AAA---------------------       67     67 ,     20     20      32:>KF668205,A/India/LKO3906/2013,2013/07/15,India,H3N2,Human,4   
                  33 >KF668206,A/India/LKO3913/2013,2013/07/16,India,H3N2,Human,4   ------------------------.GTG..GT.A.C...C....GTAG..A.T......G........GA..AAA---------------------       65     65 ,     20     20      33:>KF668206,A/India/LKO3913/2013,2013/07/16,India,H3N2,Human,4   
                  34 >KF668207,A/India/LKO3914/2013,2013/07/16,India,H3N2,Human,4   ------------------------.GTG..GT.A.C...C....GTAG..A.T..T...G........GA..AAA---------------------       66     66 ,     21     21      34:>KF668207,A/India/LKO3914/2013,2013/07/16,India,H3N2,Human,4   
                                                                                                                                                                                     
                ---Index------------------------------------------------------------TGTAACAAGACGGGTGCACTCCATGACAATACAGTACGAATTGCTGCAACGCCAGCGGCTATCAACCTAGCCCGTTAGAGCCGTGGTGCAAGCCAA 
                -codon-position-----------------------------------------------------   11  221211  1    1 2121 11 2 1 2   11     1 1  1  1 12   22 2    2 1  122  1        1         
                                                                                    000000000000000000000000000000000000000000000000000000000000000000000111111111111111111111111111 
                                                                                    000000111111222222223333444444444555555556666666667777778888889999999000000111112233444555555556 
                                                                                    034577048999012344891122135778888012445690011468891223693378891225678004588338995945124001244677 
                                                                                    998202862016598203516838906280234182369546925002705696590732735344653597378015574643683798458081



                NA has mutations A464T,A752T,A943G,




                Code:
                                                                                    00000000000000000000000000000000000000000000000000011111111111111111111111111 
                                                                                    00000112222223344444444445555666667777788888999999900000000111111111111222223 
                                                                                    02778160467780922335567780199046661135723799033344401244689000112555899047899 
                                                                                    65785954273880969591941295915933692422487618368923535947205067365568519472100 
                -codon-position----------------------------------------------------- 12 12  2  2      11 2 1 1  1 1   1  2     1  2  1 11      22     1   212   1 
                ---Index------------------------------------------------------------TATTTAAGTGAAATCCGAGGCACCACATATAACCAAGAGGCACACTTTCATAGAAGTGGGAGCAACCTAAGAGGAAA 
                   1 >Index/USA-2007                                                .............................................................................        0      0 ,      0      0       1:>Index/USA-2007                                                
                   2 >Index/Perth-like/2009                                         ............G...A.A...........G...........A..........GG......................        7      7 ,      7      7       2:>Index/Perth-like/2009                                         
                   3 >Index/2009/Egypt/Iowa                                         ..CCCG............A...T.......G..............................A.............G.        9      9 ,      9      9       3:>Index/2009/Egypt/Iowa                                         
                   4 >Index/H3N3-2011-reassortedEI/2011(H3N2)                       ..................A...........G.........T..................AC.T...........T.C        8      8 ,      8      8       4:>Index/H3N3-2011-reassortedEI/2011(H3N2)                       
                   5 >Index/H3N2-2011-normalEI/2011(H3N2)                           ......G..A........A..........AG.T...A...T....A............AAC..G......A...T.C       16     16 ,     16     16       5:>Index/H3N2-2011-normalEI/2011(H3N2)                           
                   6 >Index/2009/Egypt-Iowa+NA,2009//                               ..................A...........G.........T..................AC.............T.C        7      7 ,      7      7       6:>Index/2009/Egypt-Iowa+NA,2009//                               
                   7 >A/Czech Republic/121/2012,2012/03/06,Czech Republic           .T......CA.G.C....A...T.G.....G.T...A..AT.................AAC..........G..T.C       19     19 ,     19     19       7:>A/Czech Republic/121/2012,2012/03/06,Czech Republic           
                   8 >Index/32g12f1.c2,10-37                                        ........CA.G.C....A...T.G.....G.T...A..AT..C..............AAC....T.....G.AT.C       21     21 ,     21     21       8:>Index/32g12f1.c2,10-37                                        
                   9 >Index/32g12f1.c2,38-41                                        ........CA.G.C....A...T.G..G..G.T...A..AT..C..............AAC..........G..T.C       20     20 ,     20     20       9:>Index/32g12f1.c2,38-41                                        
                  10 >Index/32g12f1.c2,42-53                                        C......A..........A.T.....G...GC..GG....T..........G...A...AC......G....A.TGC       19     19 ,     19     19      10:>Index/32g12f1.c2,42-53                                        
                  11 >Index/32g12f1.c2,55-62                                        .......AC.G...T...A...........G.........T...T.....G.....C..AC.T.....G..G..T.C       17     17 ,     17     17      11:>Index/32g12f1.c2,55-62                                        
                  12 >KF668208,A/India/LKO799/2011,2011/07/16,India,H3N2,Human,6    --------------.T..A...TT......G.T...A...T.T....C..........AAC........G.G-----       34     34 ,     15     15      12:>KF668208,A/India/LKO799/2011,2011/07/16,India,H3N2,Human,6    
                  13 >KF668209,A/India/LKO827/2011,2011/07/25,India,H3N2,Human,6    ---------------T..A...TT......G.T...A...T.T....C..........AAC........--------       36     36 ,     13     13      13:>KF668209,A/India/LKO827/2011,2011/07/25,India,H3N2,Human,6    
                  14 >KF668210,A/India/LKO845/2011,2011/07/26,India,H3N2,Human,6    --------------.T..A...TT......G.T...A...T.T....C..........AAC........G.G-----       34     34 ,     15     15      14:>KF668210,A/India/LKO845/2011,2011/07/26,India,H3N2,Human,6    
                  15 >KF668211,A/India/LKO851/2011,2011/07/27,India,H3N2,Human,6    --------------.T..A...TT......G.T...A...T......C..........AAC..........G.----       31     31 ,     13     13      15:>KF668211,A/India/LKO851/2011,2011/07/27,India,H3N2,Human,6    
                  16 >KF668212,A/India/LKO856/2011,2011/07/28,India,H3N2,Human,6    --------------.T..A...TT......G.T...A.A.T......C..........AAC........--------       35     35 ,     13     13      16:>KF668212,A/India/LKO856/2011,2011/07/28,India,H3N2,Human,6    
                  17 >KF668213,A/India/LKO864/2011,2011/07/28,India,H3N2,Human,6    ---------------T..A...TT......G.T...A...T......C..........AAC..........G-----       33     33 ,     13     13      17:>KF668213,A/India/LKO864/2011,2011/07/28,India,H3N2,Human,6    
                  18 >KF668214,A/India/LKO871/2011,2011/07/29,India,H3N2,Human,6    ---------------T..A...TT......G.T...A...T.T....C..........AAC........--------       36     36 ,     13     13      18:>KF668214,A/India/LKO871/2011,2011/07/29,India,H3N2,Human,6    
                  19 >KF668215,A/India/LKO896/2011,2011/08/03,India,H3N2,Human,6    --------------.T..A...TT......G.T...A...T.T....C..........AAC........G.G-----       34     34 ,     15     15      19:>KF668215,A/India/LKO896/2011,2011/08/03,India,H3N2,Human,6    
                  20 >KF668216,A/India/LKO940/2011,2011/08/11,India,H3N2,Human,6    ----------------..A...TT......G.T...A...T.T....C..........AAC........--------       36     36 ,     12     12      20:>KF668216,A/India/LKO940/2011,2011/08/11,India,H3N2,Human,6    
                  21 >KF668217,A/India/LKO983/2011,2011/08/25,India,H3N2,Human,6    --------------.T..A...TT......G.T...A...T......C..........AAC........G.G-----       33     33 ,     14     14      21:>KF668217,A/India/LKO983/2011,2011/08/25,India,H3N2,Human,6    
                  22 >KF668218,A/India/LKO1442/2012,2012/01/23,India,H3N2,Human,6   ---------------T..A...TT......G.T...A...T.T....C..........AAC........--------       36     36 ,     13     13      22:>KF668218,A/India/LKO1442/2012,2012/01/23,India,H3N2,Human,6   
                  23 >KF668219,A/India/LKO1501/2012,2012/02/14,India,H3N2,Human,6   ------------------A...TT......G.T...A...T.T....C..........AAC........--------       38     38 ,     12     12      23:>KF668219,A/India/LKO1501/2012,2012/02/14,India,H3N2,Human,6   
                  24 >KF668220,A/India/LKO3108/2012,2012/12/12,India,H3N2,Human,6   ----------------.GAR..TT......G.T...A...T.T....C..........AAC........G.G-----       37     37 ,     16     16      24:>KF668220,A/India/LKO3108/2012,2012/12/12,India,H3N2,Human,6   
                  25 >KF668221,A/India/LKO3818/2013,2013/06/25,India,H3N2,Human,6   -------------------..TTT.T....G.T...AT..T......C.G........AAC..........G-----       39     39 ,     15     15      25:>KF668221,A/India/LKO3818/2013,2013/06/25,India,H3N2,Human,6   
                  26 >KF668222,A/India/LKO3824/2013,2013/06/26,India,H3N2,Human,6   ----------------------TT.T....G.T...AT..T......C.G........AAC..........G-----       41     41 ,     14     14      26:>KF668222,A/India/LKO3824/2013,2013/06/26,India,H3N2,Human,6   
                  27 >KF668223,A/India/LKO3825/2013,2013/06/26,India,H3N2,Human,6   --------------.T..A..TTT....G.G.T...AT..T......C.G........AAC..........G-----       36     36 ,     17     17      27:>KF668223,A/India/LKO3825/2013,2013/06/26,India,H3N2,Human,6   
                  28 >KF668224,A/India/LKO3839/2013,2013/06/29,India,H3N2,Human,6   --------------.T..A..TTT......G.T...AT..T......C.G........AAC...G......G-----       36     36 ,     17     17      28:>KF668224,A/India/LKO3839/2013,2013/06/29,India,H3N2,Human,6   
                  29 >KF668225,A/India/LKO3863/2013,2013/07/06,India,H3N2,Human,6   ---------------T..A..TTT......G.T...AT..T.....CC..........AAC..........G-----       36     36 ,     16     16      29:>KF668225,A/India/LKO3863/2013,2013/07/06,India,H3N2,Human,6   
                  30 >KF668226,A/India/LKO3876/2013,2013/07/09,India,H3N2,Human,6   ---------------T..A..TTT......G.T...AT..T......C.G........AAC..........G-----       36     36 ,     16     16      30:>KF668226,A/India/LKO3876/2013,2013/07/09,India,H3N2,Human,6   
                  31 >KF668227,A/India/LKO3887/2013,2013/07/10,India,H3N2,Human,6   --------------.T..A..TTT......G.TA..AT..T......C.G.......AAAC..........G-----       37     37 ,     18     18      31:>KF668227,A/India/LKO3887/2013,2013/07/10,India,H3N2,Human,6   
                  32 >KF668228,A/India/LKO3889/2013,2013/07/11,India,H3N2,Human,6   --------------.T..A..TTT......G.T...AT..TG.....C.G........AAC.....T....G-----       37     37 ,     18     18      32:>KF668228,A/India/LKO3889/2013,2013/07/11,India,H3N2,Human,6   
                  33 >KF668229,A/India/LKO3893/2013,2013/07/12,India,H3N2,Human,6   ----------------..A..TTT......G.T...AT..T......CAG..A.....AAC.........-------       39     39 ,     16     16      33:>KF668229,A/India/LKO3893/2013,2013/07/12,India,H3N2,Human,6   
                  34 >KF668230,A/India/LKO3906/2013,2013/07/15,India,H3N2,Human,6   ----------------..A..TTT......G.T...AT..T......C.G..A.....AAC..........G-----       37     37 ,     16     16      34:>KF668230,A/India/LKO3906/2013,2013/07/15,India,H3N2,Human,6   
                  35 >KF668231,A/India/LKO3913/2013,2013/07/16,India,H3N2,Human,6   ---------------T..A..TTT......G.T...AT..T......C.G........AAC..........G-----       36     36 ,     16     16      35:>KF668231,A/India/LKO3913/2013,2013/07/16,India,H3N2,Human,6   
                  36 >KF668232,A/India/LKO3914/2013,2013/07/16,India,H3N2,Human,6   -------------------..TTT......G.T...AT..T......C.G........AAC..........G-----       38     38 ,     14     14      36:>KF668232,A/India/LKO3914/2013,2013/07/16,India,H3N2,Human,6   
                                                                                                                                                                  
                ---Index------------------------------------------------------------TATTTAAGTGAAATCCGAGGCACCACATATAACCAAGAGGCACACTTTCATAGAAGTGGGAGCAACCTAAGAGGAAA 
                -codon-position----------------------------------------------------- 12 12  2  2      11 2 1 1  1 1   1  2     1  2  1 11      22     1   212   1 
                                                                                    00000000000000000000000000000000000000000000000000011111111111111111111111111 
                                                                                    00000112222223344444444445555666667777788888999999900000000111111111111222223 
                                                                                    02778160467780922335567780199046661135723799033344401244689000112555899047899 
                                                                                    65785954273880969591941295915933692422487618368923535947205067365568519472100
                I'm interested in expert panflu damage estimates
                my current links: [url]http://bit.ly/hFI7H[/url] ILI-charts: [url]http://bit.ly/CcRgT[/url]

                Comment


                • #23
                  Re: H3n2

                  2013/11/07

                  H3N2 from USA, season 2012/3 , from all states, mainly segments 4,6,7

                  Code:
                       17,Alabama/
                       58,Alaska/
                        9,Arizona/
                       18,Arkansas
                       42,Californ
                       21,Colorado
                        6,Connecti
                       30,Delaware
                        9,District
                       30,Florida/
                       15,Georgia/
                       36,Hawaii/
                       21,Idaho/
                        6,Illinois
                       12,Indiana/
                       18,Iowa/
                       18,Kansas/
                       18,Kentucky
                       18,Louisian
                       12,Maine/
                       27,Maryland
                       27,Massachu
                       28,Michigan
                       15,Minnesot
                       12,Mississi
                       15,Missouri
                       15,Montana/
                       18,Nebraska
                       24,Nevada/
                       18,New Hamp
                       15,New Jers
                       27,New Mexi
                       42,New York
                       21,North Ca
                       15,North Da
                       15,Ohio/
                       21,Oklahoma
                       15,Oregon/
                       18,Pennsylv
                       12,Rhode Is
                       12,South Ca
                       21,South Da
                        9,Tennesse
                       39,Texas/
                       12,Utah/
                       15,Vermont/
                       18,Virginia
                       32,Washingt
                       18,West Vir
                       21,Wisconsi
                       12,Wyoming/

                  Code:
                                                                              0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000011111111111111111111111111111111111111111111111111111111111111111111111111111 
                                                                              0000000000000000000001111111111111112222222222222233333333334444444444444444455555555555556666666666666677777777777777788888888888999999999999900000000000111111111111122222222223333333333334444444444455555555555666666666 
                                                                              0122233334445557778990334445667888990011223477888901124556990111233456677789900111234466990001223448889900011122336668812333477889013456777889900111345888011123566799901345567892234456667891123445789900112455677112356778 
                                                                              9812836793582570284368594676251027155609287069125130685784035389005760823822814689870314163596399032790345904516262584569037303271359446258383459147276037103551867314508654795160384732351923687398451479384547958344732013 
                  -codon-position---------------------------------------------   11  1 1  11 1       1 2      212 12        2    111  11   212 1   1 1212     2        2 2 122 111 2  2 12 11  1   12 122     2    2     21 1 1        1   2   2    1                 1           1   1 1        2 12  2   
                  ---Index----------------------------------------------------TTGAAATCGTCTACTACGGTGACACAATTTGGGTCTGATGCTCCTTGCCTCGCTTGGGACGAAGCAACCGAAGAATAGTCTAAAGCTAGAGGGGTTAGTGATCGCTCCAGACCAAGAAATCGGGCTCTACTCAGCCTTGACATACATATCGGAGCGTAGATCATGTAGGACCAGTATCGCGCTTCACGTGGGCTCCGACAGCGAAGCGGAGTATCCCAAG 
                     1 >Index/2009/Egypt/Iowa                                 ............................................................................................................................................................................................................................        0      0 ,      0      0       1:>Index/2009/Egypt/Iowa                                 
                     2 >KF790169,A/Oklahoma/04/2012(H3N2)                     ..........T..........G..............A..T.........C...C....C.A........T........................A...G...T......AG..G.A............C...............A.....T....A..............T...........C....................G.A..............       30     24 ,     30     24       2:>KF790169,A/Oklahoma/04/2012(H3N2)                     
                     3 >KF790050,A/Florida/68/2012(H3N2)                      .....................G..............A............C...CC..................................T........G...T..........G..............C...............A.....T........G......................C...T................G.A..............       18     17 ,     18     17       3:>KF790050,A/Florida/68/2012(H3N2)                      
                     4 >KF789819,A/Virginia/16/2012(H3N2)                     .....................G..............A....C.......C...CC.................................AT........G...T..C..G....G..............C.C.............A.....T...T....G......................C...T...............TG.A.....C........       25     25 ,     25     25       4:>KF789819,A/Virginia/16/2012(H3N2)                     
                     5 >KF789670,A/Virginia/15/2012(H3N2)                     .....................G..............A....C.......C...CC.................................A.........G...T..C..G....G..............C.C.............A.....T...T....G......................C...T...............TG.A.....C........       24     24 ,     24     24       5:>KF789670,A/Virginia/15/2012(H3N2)                     
                     6 >KF789706,A/Tennessee/18/2012(H3N2)                    .....................G..............A....C.......C...CC.................................A.........G...T..C..G....G..............C.C.............A.....T...T....G......................C...T...............TG.A.....C........       25     24 ,     25     24       6:>KF789706,A/Tennessee/18/2012(H3N2)                    
                     7 >KF789804,A/Virginia/16/2012(H3N2)                     .....................G..............A....C.......C...CC.................................A.........G...T..C..G....G..............C.C.............A.....T...T....G......................C...T...............TG.A.....C........       24     24 ,     24     24       7:>KF789804,A/Virginia/16/2012(H3N2)                     
                     8 >KF789782,A/Michigan/33/2012(H3N2)                     .....................G..............A....C.......C...CC.................................A.........G...T..C..G....G..............C.C.............A.....T...T....G......................C...T...............TG.A.....C........       24     24 ,     24     24       8:>KF789782,A/Michigan/33/2012(H3N2)                     
                     9 >KF790488,A/South Carolina/22/2012(H3N2)               .....................G..............A............C...CC.................................A.........G...T..C..G....G..............C.C.............A.....T...T....G......................C...T...............TG.A.....C........       23     23 ,     23     23       9:>KF790488,A/South Carolina/22/2012(H3N2)               
                    10 >KF790479,A/South Carolina/24/2012(H3N2)               .....................G..............A............C...CC.................................A.........G...T..C.TG....G..............C.C.............A.....T...T....G......................C...T...............TG.A.....C........       24     24 ,     24     24      10:>KF790479,A/South Carolina/24/2012(H3N2)               
                    11 >KF789707,A/Kentucky/18/2012(H3N2)                     .....................G..............A............C...CC.................................A.........G...T..C..G....G..............C.C.............A.....T...T....G......................C...T...............TG.A.....C........       23     23 ,     23     23      11:>KF789707,A/Kentucky/18/2012(H3N2)                     
                    12 >KF790495,A/Tennessee/10/2012(H3N2)                    .....................G..............A............C...CC.................................A.........G...T..C..G....G..............C.C.............A.....T...T....G......................C...T...............TG.A.....C.C......       25     24 ,     25     24      12:>KF790495,A/Tennessee/10/2012(H3N2)                    
                    13 >KF789604,A/Kentucky/17/2012(H3N2)                     .....................G..............A............C...CC.................................A.........G...T..C..G....G..............C.C.............A.....T...T....G......................C...T...............TG.A.....C........       23     23 ,     23     23      13:>KF789604,A/Kentucky/17/2012(H3N2)                     
                    14 >KF790048,A/South Carolina/24/2012(H3N2)               .....................G..............A............C...CC.................................A..T......G...T.YC..G....G..............C.C.............A.....T...T....G......................C...T...............TG.A.....C........       25     25 ,     25     25      14:>KF790048,A/South Carolina/24/2012(H3N2)               
                    15 >KF789899,A/Kentucky/24/2012(H3N2)                     .....................G..............A............C...CC.................................A.........G...T.YC..G....G..............C.C.............A.....T...T....G......................C...T...............TG.A.....C........       25     24 ,     25     24      15:>KF789899,A/Kentucky/24/2012(H3N2)                     
                    16 >KF790491,A/Louisiana/11/2012(H3N2)                    ..............C......G..............A............C...C.....T...................T..............C...G...T..........G.........A....C.........A.....A.....T....A...G......................C....................G.A........T.....       26     22 ,     26     22      16:>KF790491,A/Louisiana/11/2012(H3N2)                    
                    17 >KF790063,A/Delaware/23/2012(H3N2)                     C.......A...G..G.....G.G............A............C...C.........................T......................T..........G...C.....A....C........C......A..............G......................C..................T.G.A..............       23     22 ,     23     22      17:>KF790063,A/Delaware/23/2012(H3N2)                     
                    18 >KF790081,A/Delaware/23/2012(H3N2)                     C.......A...G..G.....G.G............A............C...C.........................T......................T..........G.........A....C........C......A..............G......................C..................T.G.A..............       21     21 ,     21     21      18:>KF790081,A/Delaware/23/2012(H3N2)                     
                    19 >KF789534,A/California/55/2012(H3N2)                   C.......A.T.G..G.A...GA.......A.....A............C...C........................................C.......T..........G..............C........C......A..............G....A.................C..................T.G.A..............       24     24 ,     24     24      19:>KF789534,A/California/55/2012(H3N2)                   
                    20 >KF789944,A/Florida/01/2013(H3N2)                      C.......A.T.G..G.....G........A.....A............C...C................................................T...M......G..G...........C........C......A..............G......................C..................T.G.A..............       25     22 ,     25     22      20:>KF789944,A/Florida/01/2013(H3N2)                      
                    21 >KF790287,A/South Carolina/16/2012(H3N2)               C.......A.T.G..G.....G........A.....A............C...C................................................T..........G..............C........C......A..............G......................C..................T.G.A..............       20     20 ,     20     20      21:>KF790287,A/South Carolina/16/2012(H3N2)               
                    22 >KF790212,A/Alaska/02/2013(H3N2)                       C.......A.T.G..G.....G........A.....A............C...C................................................T..........G..............C........C......A........A.....G......................C..................T.G.A..............       21     21 ,     21     21      22:>KF790212,A/Alaska/02/2013(H3N2)                       
                    23 >KF790407,A/Alaska/02/2013(H3N2)                       C.......A.T.G..G.....G........A.....A............C...C................................................T..........G..............C........C......A........A.....G......................C..................T.G.A..............       21     21 ,     21     21      23:>KF790407,A/Alaska/02/2013(H3N2)                       
                    24 >KF789805,A/Georgia/22/2012(H3N2)                      C.......A.T.G..G.....G........A.....A............C...C................................................T.......R..G..............C........C......A..............G......................C..................T.G.A..............       21     21 ,     21     21      24:>KF789805,A/Georgia/22/2012(H3N2)                      
                    25 >KF789665,A/Georgia/16/2012(H3N2)                      C....T..A...G..G.....G..............A........C...C...C.................GA........G....................T.......G..G..........T...C........C......A..............G.T....................C..................T.G.A.A............       27     27 ,     27     27      25:>KF789665,A/Georgia/16/2012(H3N2)                      
                    26 >KF789690,A/Georgia/15/2012(H3N2)                      C....T..A...G..G.....G..............A........C...C...C.................GA........G....................T.......G..G..........T...C........C......A..............G.T....................C..................T.G.A.A............       27     27 ,     27     27      26:>KF789690,A/Georgia/15/2012(H3N2)                      
                    27 >KF789983,A/Florida/39/2012(H3N2)                      C.......A...G..G.....G..............A............C..AC.A..............................................T.......G..GGA............C........C......A..............G......................C..................T.G.A..............       26     23 ,     26     23      27:>KF789983,A/Florida/39/2012(H3N2)                      
                    28 >KF789748,A/Louisiana/16/2012(H3N2)                    C.......A...G..G.....G..............A............C..AC.A..............................................T....Y.....G.A............C........C......A..............G......................C..................T.G.A..............       23     22 ,     23     22      28:>KF789748,A/Louisiana/16/2012(H3N2)                    
                    29 >KF790278,A/New York/40/2012(H3N2)                     C.......A...G..G.....G..............A............C..AC.A..............................................T..........G.A............C........C......A..............G......................C..................T.G.A..............       21     21 ,     21     21      29:>KF790278,A/New York/40/2012(H3N2)                     
                    30 >Index/32g12f1.c2,55-62                                C.......A...G..G.....G...G..........A............C..AC.............................................A..T..........G.A.......A....C........C......A....T.........G......................C..................T.G.A..............       24     24 ,     24     24      30:>Index/32g12f1.c2,55-62                                
                    31 >KF790178,A/Vermont/16/2012(H3N2)                      C.......A...G..G.....G..............A............C...C................................................T..........G.A............C........C......A..............G......................C................G.T.G.A..............       21     20 ,     21     20      31:>KF790178,A/Vermont/16/2012(H3N2)                      
                    32 >KF789680,A/Virginia/14/2012(H3N2)                     C.......A...G..G.....G..............A............C...C................................................T..........G.A............C.....T..C......A..G...........G............G.........C..................T.G.A..............       22     22 ,     22     22      32:>KF789680,A/Virginia/14/2012(H3N2)                     
                    33 >KF789674,A/Maryland/43/2012(H3N2)                     C.......A...G..G.....G..............A............C...C................................................T..........G.A............C.....T..C......A..G...........G............G.........C..................T.G.A..............       23     22 ,     23     22      33:>KF789674,A/Maryland/43/2012(H3N2)                     
                    34 >KF789912,A/Alabama/35/2012(H3N2)                      C.......A...G..G.....G..............A............C...C................................................T..........G.A............C.....T..C......A..G...........G............G.........C..................T.G.A..............       22     22 ,     22     22      34:>KF789912,A/Alabama/35/2012(H3N2)                      
                    35 >KF790242,A/Nevada/26/2012(H3N2)                       C.......A...G..G.....G..............A............C...C.................................G..............T....M.....G..............C........C......A..............G......................C..................T.G.A....A.........       23     21 ,     23     21      35:>KF790242,A/Nevada/26/2012(H3N2)                       
                    36 >KF790209,A/Mississippi/12/2012(H3N2)                  C.....C.A...G.CG.....G..............A............C...C..............G.................................T..........G..............C........C.....GA..............G......................C..................T.G.A..............       22     22 ,     22     22      36:>KF790209,A/Mississippi/12/2012(H3N2)                  
                    37 >KF790093,A/Wisconsin/37/2012(H3N2)                    C.....C.A...G.CG.....G..............A............C...C................................................T..........G..............C........C.....GA..............G......................C..................T.G.A..............       22     21 ,     22     21      37:>KF790093,A/Wisconsin/37/2012(H3N2)                    
                    38 >KF790402,A/Nebraska/04/2013(H3N2)                     C.....C.A...G.CG.....G..............A............C...C................................................T..........G..............C........C......A......A.......G......................C..................T.G.A..............       22     21 ,     22     21      38:>KF790402,A/Nebraska/04/2013(H3N2)                     
                    39 >KF790265,A/Mississippi/13/2012(H3N2)                  C.......A...G..G.....G..............A............C...C................................................T..........G..............C........C......A...Y..........G......................C..................T.G.A..............       20     19 ,     20     19      39:>KF790265,A/Mississippi/13/2012(H3N2)                  
                    40 >KF789596,A/Colorado/20/2012(H3N2)                     C.......A...G........G..............A............C...C................................................T..........G.........A....C........C......A..............G......................C..................T.G.A..............       18     18 ,     18     18      40:>KF789596,A/Colorado/20/2012(H3N2)                     
                    41 >Index/H3N3-2011-reassortedEI/2011(H3N2)               .....................G..............A............C...C................................................T..........G..............C...............A..............G......................C....................G.A..............       12     12 ,     12     12      41:>Index/H3N3-2011-reassortedEI/2011(H3N2)               
                    42 >Index/H3N2-2011-normalEI/2011(H3N2)                   C......................................T...................................................................................................G.............A..................................................................        7      4 ,      7      4      42:>Index/H3N2-2011-normalEI/2011(H3N2)                   
                    43 >KC892570,A/Pennsylvania/09/2012(H3N2)                 .......T........T........G......AAT.................................T........A...................T...........A.................G...........G..........................C....A............T................T..................       16     16 ,     16     16      43:>KC892570,A/Pennsylvania/09/2012(H3N2)                 
                    44 >KF789697,A/Pennsylvania/09/2012(H3N2)                 .......T........T........G......AAT.................................T........A.................C.T.....A.....A.................G...........G..........................C....A............T................T..................       18     18 ,     18     18      44:>KF789697,A/Pennsylvania/09/2012(H3N2)                 
                    45 >KF789838,A/Wisconsin/06/2013(H3N2)                    ................T........G......A.T.............T................G..T..G..G..A...................T...........AR................G...........G..........................C....A....A...........................G...............       20     19 ,     20     19      45:>KF789838,A/Wisconsin/06/2013(H3N2)                    
                    46 >KF789767,A/New Mexico/11/2013(H3N2)                   C...............T........G......A.T.............T................G..T..G..G.GA...................T...........AR.....G..........G...........G..........................CA...A....A.........................A.G.............G.       26     25 ,     26     25      46:>KF789767,A/New Mexico/11/2013(H3N2)                   
                    47 >KF789567,A/Idaho/03/2013(H3N2)                        C...............T........G......A.T.............T................G..T..G..G..A...................T...........A......G..........G...........G..........................CA...A....A.........................A.G.............G.       23     23 ,     23     23      47:>KF789567,A/Idaho/03/2013(H3N2)                        
                    48 >KF790514,A/Arizona/11/2012(H3N2)                      C...............T........G......A.T.............T................G..TT.G..G..A...................T...........A......G..........G...........G..........................CA...A....A.........................A.G.............G.       25     24 ,     25     24      48:>KF790514,A/Arizona/11/2012(H3N2)                      
                    49 >KF790408,A/Texas/11/2013(H3N2)                        ................T........G......A.T.............T................G..TT.G..G..A...................T...........A.................G...T.......G..........................C....A....A...........................G.............G.       21     21 ,     21     21      49:>KF790408,A/Texas/11/2013(H3N2)                        
                    50 >KF790027,A/Massachusetts/07/2013(H3N2)                ................T........G......A.T.......T.....T................G..TT.G..G..A...................T...........A.................G...........G.............A............C.A..A....A...........................G.............G.       25     23 ,     25     23      50:>KF790027,A/Massachusetts/07/2013(H3N2)                
                    51 >KF789585,A/Florida/46/2012(H3N2)                      ...........C....T...A....G......A.T.......T.....T................G..T..G..G..A...................T...........A.................G...........G..........................C....A....A...........................G.............G.       22     22 ,     22     22      51:>KF789585,A/Florida/46/2012(H3N2)                      
                    52 >KF789889,A/Wisconsin/51/2012(H3N2)                    ................T...A....G......A.T.......T.....T................G..T..G..G..A...................T...........A.................G...........G..........................C....A....A...........................G.............G.       21     21 ,     21     21      52:>KF789889,A/Wisconsin/51/2012(H3N2)                    
                    53 >KF789895,A/New Hampshire/21/2012(H3N2)                ................T...A....G......A.T.......T.....T................G..T..G..G..A...................T...........A.................G...........G..........................C....A....A...........................G.............G.       22     21 ,     22     21      53:>KF789895,A/New Hampshire/21/2012(H3N2)                
                    54 >KF790411,A/Massachusetts/05/2013(H3N2)                ................T........G......A.T.......T.....T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       21     21 ,     21     21      54:>KF790411,A/Massachusetts/05/2013(H3N2)                
                    55 >KF790310,A/Massachusetts/04/2013(H3N2)                ................T........G......A.T.......T.....T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       23     21 ,     23     21      55:>KF790310,A/Massachusetts/04/2013(H3N2)                
                    56 >KF790482,A/Florida/09/2013(H3N2)                      ................T........G......A.T.......T.....T................G..T..G..G..A...................T...........A.................G...........G.............A............C....G....A...........................G.............G.       22     21 ,     22     21      56:>KF790482,A/Florida/09/2013(H3N2)                      
                    57 >KF789954,A/Rhode Island/02/2013(H3N2)                 ................T........G......A.T.............T...............TG..T..G..G..A...................T.......C...A.................G...........G.............A............C....G....A...........................G.............G.       23     22 ,     23     22      57:>KF789954,A/Rhode Island/02/2013(H3N2)                 
                    58 >KF789731,A/New Mexico/06/2013(H3N2)                   ................T........G......A.T.............T...............TG..T..G..G..A...................T...........A.................G...........G.............A............C....G....A...........................G.............G.       21     21 ,     21     21      58:>KF789731,A/New Mexico/06/2013(H3N2)                   
                    59 >KF790148,A/Arkansas/03/2013(H3N2)                     ................T........GG.....A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....G....A...........................G.....T.......G.       22     22 ,     22     22      59:>KF790148,A/Arkansas/03/2013(H3N2)                     
                    60 >KF790144,A/Arkansas/13/2013(H3N2)                     ................T........GG.....A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....G....A...........................G.....T.......G.       23     22 ,     23     22      60:>KF790144,A/Arkansas/13/2013(H3N2)                     
                    61 >KF790136,A/Arkansas/07/2013(H3N2)                     ................T........GG.....A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....G....A...........................G.....T.......G.       22     22 ,     22     22      61:>KF790136,A/Arkansas/07/2013(H3N2)                     
                    62 >KF789970,A/Arkansas/06/2013(H3N2)                     ................T........GG.....A.T.............T................G..T..G..G..A...................T.........Y.A.................G...........G.............A............C....G....A...........................G.....T.......G.       24     23 ,     24     23      62:>KF789970,A/Arkansas/06/2013(H3N2)                     
                    63 >KF789975,A/Arkansas/04/2013(H3N2)                     ................T........GG.....A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....G....A...........................G.....T.......G.       22     22 ,     22     22      63:>KF789975,A/Arkansas/04/2013(H3N2)                     
                    64 >KF789560,A/Florida/06/2013(H3N2)                      ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       20     20 ,     20     20      64:>KF789560,A/Florida/06/2013(H3N2)                      
                    65 >KF790362,A/New York/06/2013(H3N2)                     ................T........G......A.T.............T......A.........G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       21     21 ,     21     21      65:>KF790362,A/New York/06/2013(H3N2)                     
                    66 >KF790302,A/New Jersey/02/2013(H3N2)                   ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       20     20 ,     20     20      66:>KF790302,A/New Jersey/02/2013(H3N2)                   
                    67 >KF790404,A/Iowa/02/2013(H3N2)                         ................T........G......A.T.............T................G..T..G..G..A...................C...........AR................G...........G.............A............C....A....A..........A................G.............G.       23     22 ,     23     22      67:>KF790404,A/Iowa/02/2013(H3N2)                         
                    68 >KF789635,A/Texas/09/2013(H3N2)                        ................T........G......A.T.............T................G..T..G..G..A...................T...........AG................G...........G.............A............C....A....A...........................G.............G.       21     21 ,     21     21      68:>KF789635,A/Texas/09/2013(H3N2)                        
                    69 >KF789842,A/North Carolina/06/2013(H3N2)               ................T........G......A.T.............T................G..T..G..G..A...................T...........AG................G...........G.............A............C....A....A...........................G.............G.       21     21 ,     21     21      69:>KF789842,A/North Carolina/06/2013(H3N2)               
                    70 >KF790147,A/Texas/14/2013(H3N2)                        ................T........G......A.T.............T................G..T..G..G..A..C................T...........AG................G...........G.............A............C....A....A..........................GG.............G.       24     23 ,     24     23      70:>KF790147,A/Texas/14/2013(H3N2)                        
                    71 >KF789965,A/Massachusetts/12/2013(H3N2)                ................T........G......A.T.............T................G..T..G..G..A..C................T...........A.................G...........G.............A............C....A....A..................T........G.............G.       24     22 ,     24     22      71:>KF789965,A/Massachusetts/12/2013(H3N2)                
                    72 >KF790297,A/Massachusetts/13/2013(H3N2)                .........C......T........G......A.T.............T................G..T..G..GC.A..C................T...........A.................G.........C.G.............A............C....A....A...........................G.............G.       25     24 ,     25     24      72:>KF790297,A/Massachusetts/13/2013(H3N2)                
                    73 >KF789849,A/Utah/07/2013(H3N2)                         ................T........G......A.T.............T................G..T..G..GC.A..C................T...........A.................G...........G.........T...A............C....A....A...........................G.............G.       23     23 ,     23     23      73:>KF789849,A/Utah/07/2013(H3N2)                         
                    74 >KF790427,A/Missouri/05/2013(H3N2)                     ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.........A...A............C....A....AT..........................G.............G.       22     22 ,     22     22      74:>KF790427,A/Missouri/05/2013(H3N2)                     
                    75 >KF790384,A/New Mexico/24/2012(H3N2)                   ................T........G......A.T.............T................G..T..G..G..A...................T...........AG................G...........G..........................C....A....AT..........................G.............G.       21     21 ,     21     21      75:>KF790384,A/New Mexico/24/2012(H3N2)                   
                    76 >KF790137,A/Oklahoma/03/2013(H3N2)                     ................T........G......A.T.............T.........T......G..T..G..G..A...G...............T...........AG................G...........G..........................C....A..C.A...........................G.............G.       24     23 ,     24     23      76:>KF790137,A/Oklahoma/03/2013(H3N2)                     
                    77 >KF790129,A/Virginia/06/2013(H3N2)                     C.......T.......T........G......A.T.............T.........T......G..T..G..G..A...................T...........A..T..............G...........G..........................C....A..C.A..................T........G.............G.       25     25 ,     25     25      77:>KF790129,A/Virginia/06/2013(H3N2)                     
                    78 >KF790119,A/Louisiana/04/2013(H3N2)                    ................T.A......G......A.T.............T.........T......G..T..G..G..A...................T...........A.................G...........G..........................C....A..C.A...........................G.............G.       26     22 ,     26     22      78:>KF790119,A/Louisiana/04/2013(H3N2)                    
                    79 >KF790201,A/North Carolina/01/2013(H3N2)               .........................G......A.T.............T.........T.....TG..T..G..G..A...................T...........A.................G...........G..........................C....A..C.A...........................G.............G.       22     21 ,     22     21      79:>KF790201,A/North Carolina/01/2013(H3N2)               
                    80 >KF789829,A/Connecticut/13/2012(H3N2)                  ................T........G......A.T.............T...............T...T..G..G..A...................T...........A.................G..........AG........C.................C....A....A......C....................G.............G.       22     22 ,     22     22      80:>KF789829,A/Connecticut/13/2012(H3N2)                  
                    81 >KF790118,A/Alaska/03/2013(H3N2)                       ................T........G.C....A.T.............T................GG.T..G..G..A...................T...........A....G............G...........G........C.................C....A....A...........................G.............G.       24     23 ,     24     23      81:>KF790118,A/Alaska/03/2013(H3N2)                       
                    82 >KF789562,A/Massachusetts/06/2013(H3N2)                ................T........G.C....A.T.............T................GG.T..G..G..A...................T...........A.................G...........G........C.................C....A....A...........................G.............G.       22     22 ,     22     22      82:>KF789562,A/Massachusetts/06/2013(H3N2)                
                    83 >KF789891,A/Kansas/16/2012(H3N2)                       ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G........C.................C....A....A...........................G.............G.       20     20 ,     20     20      83:>KF789891,A/Kansas/16/2012(H3N2)                       
                    84 >KF790053,A/Wyoming/01/2013(H3N2)                      ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G........C.................C....A....A...........................G..........S..G.       22     21 ,     22     21      84:>KF790053,A/Wyoming/01/2013(H3N2)                      
                    85 >KF790225,A/Texas/82/2012(H3N2)                        ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G..........................C....A....A...........................G.............G.       19     19 ,     19     19      85:>KF790225,A/Texas/82/2012(H3N2)                        
                    86 >KF790414,A/Nebraska/03/2013(H3N2)                     ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G..........................C....A....A...........................G.............G.       21     19 ,     21     19      86:>KF790414,A/Nebraska/03/2013(H3N2)                     
                    87 >KF790311,A/Nebraska/15/2012(H3N2)                     ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G..........................C....A....A...........................G.............G.       19     19 ,     19     19      87:>KF790311,A/Nebraska/15/2012(H3N2)                     
                    88 >KF789810,A/Iowa/22/2012(H3N2)                         ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G.T.........G..........................C....A....A...........................G.............G.       20     20 ,     20     20      88:>KF789810,A/Iowa/22/2012(H3N2)                         
                    89 >KF789966,A/Rhode Island/06/2013(H3N2)                 ................T........G......A.T.............T................G..T..G..G..A.........G....A....T...........A.................A.T.........G..........................C....A....A...........................G...............       23     21 ,     23     21      89:>KF789966,A/Rhode Island/06/2013(H3N2)                 
                    90 >KF790180,A/New York/37/2012(H3N2)                     ................T........G......A.T.............T................G..T..G..G..A.........G.........T...........A.................A.T.........G..........................C....A....A...........................G.............G.       21     21 ,     21     21      90:>KF790180,A/New York/37/2012(H3N2)                     
                    91 >KF789958,A/West Virginia/01/2013(H3N2)                ................T........G......A.T.............TY...............G..T..G..G..A.........GR........T...........A.................A.T.........G..........................C....A....A...........................G.............G.       23     23 ,     23     23      91:>KF789958,A/West Virginia/01/2013(H3N2)                
                    92 >KF790258,A/New York/39/2012(H3N2)                     ................T........G......A.T.............T................G..T..G..G..A.........G.........T...........A.................A.T.........G..........................C....A....A...........................G.............G.       21     21 ,     21     21      92:>KF790258,A/New York/39/2012(H3N2)                     
                    93 >KF789872,A/Hawaii/02/2013(H3N2)                       ................T........G......A.T.............T................G..T..G..G..A.........G.........T.........T.AG................A.T.........G..........................C....A....A...........................G.............G.       23     23 ,     23     23      93:>KF789872,A/Hawaii/02/2013(H3N2)                       
                    94 >KF790224,A/Rhode Island/08/2012(H3N2)                 ................T........G......A.T.............T................G..T..G..G..A.........G.........T...........A.................A.T.........G..........................C....A....A...........................G.............G.       21     21 ,     21     21      94:>KF790224,A/Rhode Island/08/2012(H3N2)                 
                    95 >KF790277,A/New York/39/2012(H3N2)                     ................T........G......A.T.............T................G..T..G..G..A.........G...K.....T......M....A.................A.T.........G..........................C....A....A...........................G.............G.       24     23 ,     24     23      95:>KF790277,A/New York/39/2012(H3N2)                     
                    96 >KF789774,A/Massachusetts/11/2013(H3N2)                ................T........G......A.T...........A.T................G..T..G..G..A...................T...........A.................G...........G.......G..................C....A....A...........................G.............G.       22     21 ,     22     21      96:>KF789774,A/Massachusetts/11/2013(H3N2)                
                    97 >KF790232,A/Iowa/14/2012(H3N2)                         ................T........G......A.T.............T................G..T..G..G..A...................T...Y.......A.................G...........G..........................C....A....A...........................G.............G.       20     20 ,     20     20      97:>KF790232,A/Iowa/14/2012(H3N2)                         
                    98 >KF789841,A/New Jersey/03/2013(H3N2)                   ................T........G......A.T.............T................G..T..G..G..A..............A....T...........A.................G...........G..........................C....A....A...........................G.............G.       20     20 ,     20     20      98:>KF789841,A/New Jersey/03/2013(H3N2)                   
                    99 >KF790416,A/Iowa/01/2013(H3N2)                         ................T........G......A.T.............T........A.......G..T..G..G..A...................T...........A.................G...........G..........................C....A....A...........................G.............G.       21     20 ,     21     20      99:>KF790416,A/Iowa/01/2013(H3N2)                         
                   100 >KF790248,A/Iowa/15/2012(H3N2)                         ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G..........................C....A....A...........................G.............G.       19     19 ,     19     19     100:>KF790248,A/Iowa/15/2012(H3N2)                         
                   101 >KF790459,A/North Dakota/01/2013(H3N2)                 ..........T.....T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G..........................C....A....A...........................G.............G.       21     20 ,     21     20     101:>KF790459,A/North Dakota/01/2013(H3N2)                 
                   102 >KF790483,A/West Virginia/11/2013(H3N2)                .........A......T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G..........................C....A....A........G..C...............G.............G.       22     22 ,     22     22     102:>KF790483,A/West Virginia/11/2013(H3N2)                
                   103 >KF789974,A/West Virginia/05/2013(H3N2)                .........A......T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G..........................C....A....A........G..C...............G.............G.       22     22 ,     22     22     103:>KF789974,A/West Virginia/05/2013(H3N2)                
                   104 >KF789858,A/West Virginia/10/2013(H3N2)                .........A......T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G..........................C....A....A........G..C...............G.............G.       22     22 ,     22     22     104:>KF789858,A/West Virginia/10/2013(H3N2)                
                   105 >KF789978,A/West Virginia/06/2013(H3N2)                .........A......T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G..........................C....A....A........G..C...............G.............G.       22     22 ,     22     22     105:>KF789978,A/West Virginia/06/2013(H3N2)                
                   106 >KF790419,A/New York/60/2012(H3N2)                     ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G..........................C....A....A...........................G.............G.       19     19 ,     19     19     106:>KF790419,A/New York/60/2012(H3N2)                     
                   107 >KF789736,A/Montana/03/2013(H3N2)                      ................T........G......A.T.............T................G..T..G..G..A...................T...........A...............C.G...........G..........................C....A....A...........................G.............G.       22     20 ,     22     20     107:>KF789736,A/Montana/03/2013(H3N2)                      
                   108 >KF789770,A/North Carolina/28/2012(H3N2)               ................T........G......A.T.............T................G..TK.G..G..A...................T...........A...............C.G...........G..........................C....A....A...........................G.............G.       22     21 ,     22     21     108:>KF789770,A/North Carolina/28/2012(H3N2)               
                   109 >KF790339,A/Delaware/06/2013(H3N2)                     ................T...............A.T.............T................G..TK.G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       24     22 ,     24     22     109:>KF790339,A/Delaware/06/2013(H3N2)                     
                   110 >KF789637,A/Idaho/24/2012(H3N2)                        ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     110:>KF789637,A/Idaho/24/2012(H3N2)                        
                   111 >KF789828,A/Idaho/38/2012(H3N2)                        ................T...............A.T.............T................G..T..G..G..A....G..............T...........AR................G...........G..........................C..G.A....A.A.........................G.............G.       23     22 ,     23     22     111:>KF789828,A/Idaho/38/2012(H3N2)                        
                   112 >KF789541,A/Colorado/02/2013(H3N2)                     ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     112:>KF789541,A/Colorado/02/2013(H3N2)                     
                   113 >KF790127,A/Colorado/27/2012(H3N2)                     ................T...............A.T.............T................G..T..G..G..A.T..G..............T...........A.................G...........G.........M................C..G.A....A.A.........................G.............G.       23     23 ,     23     23     113:>KF790127,A/Colorado/27/2012(H3N2)                     
                   114 >KF789544,A/Washington/06/2013(H3N2)                   ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     114:>KF789544,A/Washington/06/2013(H3N2)                   
                   115 >KF790418,A/New Hampshire/03/2013(H3N2)                ................TA..............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       23     22 ,     23     22     115:>KF790418,A/New Hampshire/03/2013(H3N2)                
                   116 >KF789627,A/California/16/2013(H3N2)                   ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     116:>KF789627,A/California/16/2013(H3N2)                   
                   117 >KF789847,A/Washington/07/2013(H3N2)                   ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       23     21 ,     23     21     117:>KF789847,A/Washington/07/2013(H3N2)                   
                   118 >KF789753,A/Washington/60/2012(H3N2)                   ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     118:>KF789753,A/Washington/60/2012(H3N2)                   
                   119 >KF789799,A/Idaho/37/2012(H3N2)                        ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       24     21 ,     24     21     119:>KF789799,A/Idaho/37/2012(H3N2)                        
                   120 >KF789947,A/Alaska/01/2013(H3N2)                       ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     120:>KF789947,A/Alaska/01/2013(H3N2)                       
                   121 >KF790527,A/Minnesota/17/2012(H3N2)                    ................T...............A.T.............T..........T.....G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       22     22 ,     22     22     121:>KF790527,A/Minnesota/17/2012(H3N2)                    
                   122 >KF790348,A/Utah/03/2013(H3N2)                         ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     122:>KF790348,A/Utah/03/2013(H3N2)                         
                   123 >KF790503,A/Nevada/03/2013(H3N2)                       ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.............T...........G.............G.       23     22 ,     23     22     123:>KF790503,A/Nevada/03/2013(H3N2)                       
                   124 >KF790329,A/Nevada/36/2012(H3N2)                       ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.............T...........G.............G.       22     22 ,     22     22     124:>KF790329,A/Nevada/36/2012(H3N2)                       
                   125 >KF789915,A/Delaware/24/2012(H3N2)                     ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     125:>KF789915,A/Delaware/24/2012(H3N2)                     
                   126 >KF790065,A/Minnesota/01/2013(H3N2)                    C...............T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.....A.......G.       23     23 ,     23     23     126:>KF790065,A/Minnesota/01/2013(H3N2)                    
                   127 >KF789957,A/Montana/01/2013(H3N2)                      ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     127:>KF789957,A/Montana/01/2013(H3N2)                      
                   128 >KF790214,A/Idaho/23/2012(H3N2)                        ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     128:>KF790214,A/Idaho/23/2012(H3N2)                        
                   129 >KF790330,A/Maryland/01/2013(H3N2)                     ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       23     21 ,     23     21     129:>KF790330,A/Maryland/01/2013(H3N2)                     
                   130 >KF790001,A/Washington/50/2012(H3N2)                   ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     130:>KF790001,A/Washington/50/2012(H3N2)                   
                   131 >KF790077,A/Oregon/15/2012(H3N2)                       ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G......C...................C..G.A....A.A.........................G.............G.       22     22 ,     22     22     131:>KF790077,A/Oregon/15/2012(H3N2)                       
                   132 >KF789818,A/Washington/61/2012(H3N2)                   ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     132:>KF789818,A/Washington/61/2012(H3N2)                   
                   133 >KF790438,A/Utah/27/2012(H3N2)                         ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..................A.......C..G.A....A.A.........................G.............G.       22     22 ,     22     22     133:>KF790438,A/Utah/27/2012(H3N2)                         
                   134 >KF789590,A/Nevada/27/2012(H3N2)                       ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     134:>KF789590,A/Nevada/27/2012(H3N2)                       
                   135 >KF790331,A/Washington/04/2013(H3N2)                   ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       22     21 ,     22     21     135:>KF790331,A/Washington/04/2013(H3N2)                   
                   136 >KF789539,A/Michigan/01/2013(H3N2)                     ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     136:>KF789539,A/Michigan/01/2013(H3N2)                     
                   137 >KF790516,A/Washington/53/2012(H3N2)                   ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       22     21 ,     22     21     137:>KF790516,A/Washington/53/2012(H3N2)                   
                   138 >KF790307,A/Missouri/02/2013(H3N2)                     ................T...............A.T.............T................G..T..G..G..A....G..............T...........A.................G...........G..........................C..G.A....A.A.........................G.............G.       21     21 ,     21     21     138:>KF790307,A/Missouri/02/2013(H3N2)                     
                   139 >KF790076,A/Nebraska/02/2013(H3N2)                     ................T...............A.T.............T................G..T..G..G..A....G.............GT...........A.................G...........G.................T........C..G.A....A.A.........................G.............G.       24     23 ,     24     23     139:>KF790076,A/Nebraska/02/2013(H3N2)                     
                   140 >KF789623,A/Kentucky/03/2013(H3N2)                     ................T........G......A.T.............T...........A....G..T..G..G..A..................GT...........A.................G......T....G..........................C....A....A...........................G.............G.       23     22 ,     23     22     140:>KF789623,A/Kentucky/03/2013(H3N2)                     
                   141 >KF789597,A/Alabama/24/2012(H3N2)                      ................T........G......A.T.............T...........A....G..T..G..G..A..................GT...........A.................G......T....G..........................C....A....A...........................G.............G.       22     22 ,     22     22     141:>KF789597,A/Alabama/24/2012(H3N2)                      
                   142 >KF790114,A/Alabama/17/2012(H3N2)                      ................T........G......A.T.............T...........A....G..T..G..G..A..................GT...........A.................G......T....G..........................C....A....A...........................G.............G.       22     22 ,     22     22     142:>KF790114,A/Alabama/17/2012(H3N2)                      
                   143 >KF789600,A/Montana/13/2012(H3N2)                      ................T........G......A.T.............T...........A....G..T..G..G..A..................GT...........A.................G......T....G..........................C....A....A...........................G.............G.       23     22 ,     23     22     143:>KF789600,A/Montana/13/2012(H3N2)                      
                   144 >KF790351,A/Kentucky/01/2013(H3N2)                     ................T........G......A.T.............T...........A....G..T..G..G..A..................GT...........A.................G......T....G..........................C....A....A...........................G.............G.       22     22 ,     22     22     144:>KF790351,A/Kentucky/01/2013(H3N2)                     
                   145 >KF790257,A/Alabama/18/2012(H3N2)                      ................T........G......A.T.............T...........A....G..T..G..G..A..................GT...........A.................G......T....G..........................C....A....A...........................G.............G.       23     22 ,     23     22     145:>KF790257,A/Alabama/18/2012(H3N2)                      
                   146 >KF789662,A/Alabama/17/2012(H3N2)                      ................T........G......A.T.............T...........A....G..T..G..G..A..................GT...........A.................G......T....G..........................C....A....A...........................G.............G.       22     22 ,     22     22     146:>KF789662,A/Alabama/17/2012(H3N2)                      
                   147 >KF789949,A/New York/04/2013(H3N2)                     ......C.........T........G......A.T.............T...........A....G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.........T...G.       23     23 ,     23     23     147:>KF789949,A/New York/04/2013(H3N2)                     
                   148 >KF789879,A/Virginia/03/2013(H3N2)                     ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       20     20 ,     20     20     148:>KF789879,A/Virginia/03/2013(H3N2)                     
                   149 >KF790010,A/Wisconsin/08/2013(H3N2)                    ................T........G......A.T.............T....C...........G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       22     21 ,     22     21     149:>KF790010,A/Wisconsin/08/2013(H3N2)                    
                   150 >KF790389,A/Minnesota/04/2013(H3N2)                    ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       22     20 ,     22     20     150:>KF790389,A/Minnesota/04/2013(H3N2)                    
                   151 >KF789968,A/Florida/21/2013(H3N2)                      ................T........G......A.T.............T................G..T..G..G..A......A............T...........A.................G...........G.............A............C....A....A...........................G.............G.       22     21 ,     22     21     151:>KF789968,A/Florida/21/2013(H3N2)                      
                   152 >KF790032,A/Florida/08/2013(H3N2)                      ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       20     20 ,     20     20     152:>KF790032,A/Florida/08/2013(H3N2)                      
                   153 >KF790037,A/North Dakota/02/2013(H3N2)                 ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A.A..............C..........G.............G.       22     22 ,     22     22     153:>KF790037,A/North Dakota/02/2013(H3N2)                 
                   154 >KF789840,A/California/18/2013(H3N2)                   ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A................C..........G.............G.       21     21 ,     21     21     154:>KF789840,A/California/18/2013(H3N2)                   
                   155 >KF789874,A/Massachusetts/15/2012(H3N2)                ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       21     20 ,     21     20     155:>KF789874,A/Massachusetts/15/2012(H3N2)                
                   156 >KF789888,A/New Jersey/05/2013(H3N2)                   ............G...T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       21     21 ,     21     21     156:>KF789888,A/New Jersey/05/2013(H3N2)                   
                   157 >KF790256,A/Pennsylvania/20/2012(H3N2)                 ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       20     20 ,     20     20     157:>KF790256,A/Pennsylvania/20/2012(H3N2)                 
                   158 >KF790403,A/Delaware/08/2013(H3N2)                     ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       21     20 ,     21     20     158:>KF790403,A/Delaware/08/2013(H3N2)                     
                   159 >KF789822,A/New York/47/2012(H3N2)                     ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       20     20 ,     20     20     159:>KF789822,A/New York/47/2012(H3N2)                     
                   160 >KF789630,A/Wyoming/03/2013(H3N2)                      ................T.A......G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       21     21 ,     21     21     160:>KF789630,A/Wyoming/03/2013(H3N2)                      
                   161 >KF790039,A/New York/05/2013(H3N2)                     ................T........G......A.T.............T................G..T..G..G..A...................T...........A.................G...........G.............A............C....A....A.........T...............A.G.............G.       22     22 ,     22     22     161:>KF790039,A/New York/05/2013(H3N2)                     
                   162 >KF789660,A/Maryland/06/2013(H3N2)                     ................T........G......A.T.............T................G..T..G..G..A...................T.........T.A.................G...........G..........................C....A....A.........T.................G.............G.       24     21 ,     24     21     162:>KF789660,A/Maryland/06/2013(H3N2)                     
                   163 >KF789591,A/New Jersey/04/2012(H3N2)                   ................T........G......A.T.............T.T.................T..G..G..A...................T...........A.................G...........G..........................C....A....A...........................GA.......C....G.       21     21 ,     21     21     163:>KF789591,A/New Jersey/04/2012(H3N2)                   
                   164 >KF789671,A/New Jersey/08/2012(H3N2)                   ................T........G......A.T.............T...................T..G..G..A...................T...........A.................G...........G.............A............C....A....A...........................G.............G.       20     19 ,     20     19     164:>KF789671,A/New Jersey/08/2012(H3N2)                   
                   165 >KC892601,A/Alaska/04/2012(H3N2)                       ................T..G.....G......A.T.............T..................TT.....G.GA...................T...........A.................G...........G..........................C....A...G..................T.........G.............G.       21     21 ,     21     21     165:>KC892601,A/Alaska/04/2012(H3N2)                       
                   166 >KF790088,A/Alaska/04/2012(H3N2)                       ................T..G.....G......A.T.............T..................TT.....G.GA.............T.....T...........A........G........G...........G..........................C....A...G..................T.........G.............G.       24     23 ,     24     23     166:>KF790088,A/Alaska/04/2012(H3N2)                       
                   167 >KF790275,A/Arizona/09/2012(H3N2)                      ................T........G..C...A.T........T....T...................T.....G..A.............TT....T...........A.....A..S........G...A.......G......C...................C....A................................G.............G.       24     24 ,     24     24     167:>KF790275,A/Arizona/09/2012(H3N2)                      
                   168 >KF790270,A/Arizona/09/2012(H3N2)                      ................T........G..C...A.T........T....T...................T.....G..A..............T....T...........A.....A...........G...A.......G......C...................C....A................................G.............G.       22     22 ,     22     22     168:>KF790270,A/Arizona/09/2012(H3N2)                      
                   169 >KF790286,A/Indiana/161/2012(H3N2)                     ................T........G..C...A.T........T....T...................T.....G..A..............T....T...........AG....A...........G...A.......G......C...................C....A................................G.............G.       24     23 ,     24     23     169:>KF790286,A/Indiana/161/2012(H3N2)                     
                   170 >KF789871,A/Michigan/02/2013(H3N2)                     ................T........G......A.T........T....T...................TT....GC.A........C..........T...........AG....A...........G...A.......G......C...................C....A................................GA............G.       26     25 ,     26     25     170:>KF789871,A/Michigan/02/2013(H3N2)                     
                   171 >KF790011,A/Oklahoma/08/2013(H3N2)                     ................T........G......A.T........T....T...................T.....G..A........C..........T...........A.....A...........G...A.......G......C...................C....A................................G.............G.       23     21 ,     23     21     171:>KF790011,A/Oklahoma/08/2013(H3N2)                     
                   172 >KF790345,A/Indiana/01/2013(H3N2)                      ................T........G......A.T........T....T...................T.....G..A........C..........T...........A.....A...........G...A.......G......C...................C....A................................G.............G.       22     21 ,     22     21     172:>KF790345,A/Indiana/01/2013(H3N2)                      
                   173 >KF789998,A/Montana/10/2012(H3N2)                      ................T........G......A.T........T....T...................T.....G..A...................T...........A.....A...........G...A.......G......C...........A.......C....A.............G..................G.............G.       22     22 ,     22     22     173:>KF789998,A/Montana/10/2012(H3N2)                      
                   174 >KF789613,A/North Carolina/04/2013(H3N2)               ................T....G...G......A.T........T....T...................T.....G..A...................T...........A.....A...........G...A.......G......C...................C....A................................G.............G.       22     21 ,     22     21     174:>KF789613,A/North Carolina/04/2013(H3N2)               
                   175 >KF790378,A/Alaska/05/2013(H3N2)                       ................T........G......A.T........T....T...................T.....G..A...................T...G.......A.....A...........G...A.......G......C...................C....A................................G.............G.       21     21 ,     21     21     175:>KF790378,A/Alaska/05/2013(H3N2)                       
                   176 >KF790109,A/Delaware/10/2012(H3N2)                     ................T........G......A.T........T....T...................T.....G..A.......T...........T...........A.....A...........G...A.......G......C...................C....A................................G.............G.       21     21 ,     21     21     176:>KF790109,A/Delaware/10/2012(H3N2)                     
                   177 >KF790429,A/Delaware/11/2012(H3N2)                     ................T........G......A.T........T....T...................T.....G..A.......T...........T...........A.....A...........G...A.......G......C...................C....A................................G.............G.       21     21 ,     21     21     177:>KF790429,A/Delaware/11/2012(H3N2)                     
                   178 >KF789701,A/Delaware/01/2013(H3N2)                     ................T........G......A.T........T....T...................T.....G..A.......T...........T...........A.....A...........G...A.......G......C...................C....A................................G.............G.       21     21 ,     21     21     178:>KF789701,A/Delaware/01/2013(H3N2)                     
                   179 >KF790440,A/Delaware/15/2012(H3N2)                     ................T........G......A.T........T....T...................T.....G..A.......T...........T...........A.....A...........G...A.......G......C...................C....A................................G.............G.       21     21 ,     21     21     179:>KF790440,A/Delaware/15/2012(H3N2)                     
                   180 >KF789569,A/Alaska/06/2013(H3N2)                       ................T........G......A.T........T....T....C..............T.....G..A...................T...........A.....A...........G...A.......G......C...................C....A................................G.............G.       21     21 ,     21     21     180:>KF789569,A/Alaska/06/2013(H3N2)                       
                   181 >KF790167,A/Washington/52/2012(H3N2)                   ................T........G......A.T........T....T....C..............T.....G..A...................T...........A.....A...........G...A.......G..........................C....A................................G.............G.       20     20 ,     20     20     181:>KF790167,A/Washington/52/2012(H3N2)                   
                   182 >KF789780,A/Kansas/14/2012(H3N2)                       ................T........G......A.T........T....T...................T.....G..A...................T...........A.....A...........G...A.......G.G........................C....A................................G.............G.       20     20 ,     20     20     182:>KF789780,A/Kansas/14/2012(H3N2)                       
                   183 >KF790464,A/Oklahoma/05/2013(H3N2)                     ................T........G......A.T........T....T...................T.....G..A...................T...........A.....A...........G...A.......G.G........................C....A................................G.............G.       20     20 ,     20     20     183:>KF790464,A/Oklahoma/05/2013(H3N2)                     
                   184 >KF790360,A/Oklahoma/05/2013(H3N2)                     ................T........G......A.T........T....T...................T.....G..A.............T.....T......Y....A.....A...........G...A.......G.G........................C....A................................G.............G.       22     22 ,     22     22     184:>KF790360,A/Oklahoma/05/2013(H3N2)                     
                   185 >KF790197,A/Florida/40/2012(H3N2)                      ................T........G......A.T........T....T..A................T.....G..A.A...........T.....T...........A.....A...........G...A.......G..........................C....A................................G.............G.       23     22 ,     23     22     185:>KF790197,A/Florida/40/2012(H3N2)                      
                   186 >KF789661,A/Hawaii/24/2012(H3N2)                       ................T........G......A.T........T....T..A................T.....G..A...................T.........Y.A.....A...........G...A.......G..........................C....A................................G.............G.       22     21 ,     22     21     186:>KF789661,A/Hawaii/24/2012(H3N2)                       
                   187 >KF790064,A/Vermont/28/2012(H3N2)                      ...G............T........G......A.T........T....T..A................T.....G..A.................C.T...........A.....A...........G...A.......G..........................C....A................................G.............G.       23     22 ,     23     22     187:>KF790064,A/Vermont/28/2012(H3N2)                      
                   188 >KF790084,A/Vermont/28/2012(H3N2)                      ...G............T........G......A.T........T....T..A................T.....G..A...................T...........AR....A...........G...A.......G..........................C....A................................G.............G.       22     22 ,     22     22     188:>KF790084,A/Vermont/28/2012(H3N2)                      
                   189 >KF789714,A/Texas/91/2012(H3N2)                        ................T........G......A.T........T....T.T.................T.....G..A...................T...........AG....A...........G...A.......G..........................C....A................................G.............G.       21     21 ,     21     21     189:>KF789714,A/Texas/91/2012(H3N2)                        
                   190 >KF789614,A/Maryland/03/2013(H3N2)                     ................T........G......A.T........T....T...................T.....G..A...................T...........A.....A...........G...A.......G..........................C....A.................A..............G.............G.       21     20 ,     21     20     190:>KF789614,A/Maryland/03/2013(H3N2)                     
                   191 >KF790356,A/Utah/02/2013(H3N2)                         ................T........G......A.T........T....T...................T.....G..A...................T...........A.....A...........G...A.......G..........................C....A................................G.............G.       20     19 ,     20     19     191:>KF790356,A/Utah/02/2013(H3N2)                         
                   192 >KF790153,A/California/04/2013(H3N2)                   ................T........G......A.T........T....T...................T.....G..A...................T...........A.....A...........G...A.......G..........................C....A................................G.............G.       20     19 ,     20     19     192:>KF790153,A/California/04/2013(H3N2)                   
                   193 >KF790457,A/New Mexico/05/2013(H3N2)                   ................T........G......A.T........T....T...................T.....G..A...................T...........A.....A...........G...A.......G..........................C....A................................G.............G.       19     19 ,     19     19     193:>KF790457,A/New Mexico/05/2013(H3N2)                   
                   194 >KF789684,A/Rhode Island/09/2012(H3N2)                 ................T........G......A.T........T....T........A..........T.....G..A...................T.........M.A.....A...........G...A.......G..........................C....A................................G.............G.       21     21 ,     21     21     194:>KF789684,A/Rhode Island/09/2012(H3N2)                 
                   195 >KF789547,A/Pennsylvania/03/2013(H3N2)                 ................T........G......A.T........T....T........A..........T.....G..A...................T...........A.....A.....A.....G...A.......G..........................C....A................................G.............G.       22     21 ,     22     21     195:>KF789547,A/Pennsylvania/03/2013(H3N2)                 
                   196 >Index/32g12f1.c2,10-37                                ................T........G......A.T........T....T...................T.....G..A...................T...........A.....A...........G...A.......G..........................C....A................................G.............G.       19     19 ,     19     19     196:>Index/32g12f1.c2,10-37                                
                   197 >KF789752,A/Oregon/12/2012(H3N2)                       ................T........G......A.T........T....T...................T.....G..A...................T...........A.....A...........G...A.......G..........................C....A................................G.............G.       22     19 ,     22     19     197:>KF789752,A/Oregon/12/2012(H3N2)                       
                   198 >KF790532,A/Maryland/05/2013(H3N2)                     .............A..T........G......A.T........T....T...................T..G..G..A...................T...........A.....A....A......G...A.......G..........................C....A................................G.............G.       22     22 ,     22     22     198:>KF790532,A/Maryland/05/2013(H3N2)                     
                   199 >KF790316,A/District Of Columbia/02/2012(H3N2)         .............A..T........G......A.T...C....T....T...................T..G..G..A...................T........A..A.....A....A......G...A.......G..........................C....A................................G.............G.       24     24 ,     24     24     199:>KF790316,A/District Of Columbia/02/2012(H3N2)         
                   200 >KF790361,A/Florida/12/2013(H3N2)                      .............A..T........G......A.T........T....T...................T.....G..A...................T...........A.....A....A......G...A.......G........C.................C....A................................G.............G.       22     22 ,     22     22     200:>KF790361,A/Florida/12/2013(H3N2)                      
                   201 >KF789618,A/Nebraska/06/2013(H3N2)                     .............A..T........G......A.T........T....T...................T.....G..A...................T...........A.....A....A......G...A.......G..........................C....A................................G.............G.       22     21 ,     22     21     201:>KF789618,A/Nebraska/06/2013(H3N2)                     
                   202 >KF790106,A/Kentucky/16/2012(H3N2)                     ......C......A..T........G......A.T........T....T...................T.....G..A...................T...........A.....A....A......G...A.......G..........................C....A................................G.............G.       22     22 ,     22     22     202:>KF790106,A/Kentucky/16/2012(H3N2)                     
                   203 >KF790059,A/Texas/111/2012(H3N2)                       ................T........G......A.T........T....T...................T.....G..A...................T...........A.....A...........G...A.......G..........................C....A................................G.............G.       19     19 ,     19     19     203:>KF790059,A/Texas/111/2012(H3N2)                       
                   204 >KF790060,A/Texas/81/2012(H3N2)                        ................T........G......A.T........T....T...................T.....G..A...................T...........A.....A...........G...A.......G.............A............C....A................................G.............G.       20     20 ,     20     20     204:>KF790060,A/Texas/81/2012(H3N2)                        
                   205 >KF790448,A/California/42/2012(H3N2)                   ................T........G......A.T........T....T...................T.....G..A...................T...........A.....A...........G...A.......G.............A............C....A................................G.............G.       21     20 ,     21     20     205:>KF790448,A/California/42/2012(H3N2)                   
                   206 >KF789535,A/California/15/2013(H3N2)                   ................T........G......A.T........T...AT...................T.G...G..A...................T...........A.....A...........G...A.......G..........................C....A................................G..A..........G.       22     22 ,     22     22     206:>KF789535,A/California/15/2013(H3N2)                   
                   207 >KF789725,A/Montana/14/2012(H3N2)                      ................T........G......A.T........T...AT...................T.G...G..A...................T...........A.....A...........G...A.......G..........................C....A................................G..A..........G.       22     22 ,     22     22     207:>KF789725,A/Montana/14/2012(H3N2)                      
                   208 >KF789982,A/New York/35/2012(H3N2)                     ................T........G......A.T........T....T...................T.....G..A...................T...........A.....A...........G...A.......G..........................C....A................................G.............G.       22     19 ,     22     19     208:>KF789982,A/New York/35/2012(H3N2)                     
                   209 >KF790049,A/Texas/01/2013(H3N2)                        ................T........G......A.T.............T...................TT....G..A...................T...........A.....A...........G...A.......G..........................C....A................................G...............       18     18 ,     18     18     209:>KF790049,A/Texas/01/2013(H3N2)                        
                   210 >KF790524,A/Maryland/33/2012(H3N2)                     ................T........G......A.T.............T...................T.....G..A...................T...........A.................G......T....G..................A.....A.C....A................................G.............G.       22     19 ,     22     19     210:>KF790524,A/Maryland/33/2012(H3N2)                     
                   211 >KF790325,A/Delaware/07/2013(H3N2)                     ................T........G......T.T.............T...................T...A.G..A...................T...........AR................G...........G..........................C....A................................G.............G.       18     18 ,     18     18     211:>KF790325,A/Delaware/07/2013(H3N2)                     
                   212 >KF789664,A/Maryland/29/2012(H3N2)                     ................T........G......A.T.............T...................T.....G..A...................T...........A.................G...........G..........................C....A...........................G....G.............G.       18     17 ,     18     17     212:>KF789664,A/Maryland/29/2012(H3N2)                     
                   213 >Index/32g12f1.c2,38-41                                ................T........G......A.T....A........T..............A....T.....G..A..............A....T...........A.................G...........G..........................C....A...............................GG.............G.       23     20 ,     23     20     213:>Index/32g12f1.c2,38-41                                
                   214 >KF790138,A/North Carolina/02/2013(H3N2)               ................T........G......A.T..G..........T...................T.....G..A...................T...........A.................G....C......G..........................C....A...............................GG.............G.       20     19 ,     20     19     214:>KF790138,A/North Carolina/02/2013(H3N2)               
                   215 >KF789615,A/Oklahoma/06/2013(H3N2)                     ................T........G......A.T...........A.T...................T.....G..A...................T...........A.................G....C......G..........................C....A...............................GG............GG.       20     20 ,     20     20     215:>KF789615,A/Oklahoma/06/2013(H3N2)                     
                   216 >KF790019,A/New Mexico/08/2013(H3N2)                   ................T........G......A.T.............T...................T.....G..A...................T...........A.................G....C......G..........................C....A...............................GG............GG.       21     19 ,     21     19     216:>KF790019,A/New Mexico/08/2013(H3N2)                   
                   217 >KF790398,A/District Of Columbia/01/2013(H3N2)         ................T........G......A.T.............T...................T.....G..A...................T...........A.................G...........G.........................CC....A...............................GG.............G.       20     18 ,     20     18     217:>KF790398,A/District Of Columbia/01/2013(H3N2)         
                   218 >KF789571,A/Alabama/07/2013(H3N2)                      ................T........G...C..A.T.........C...T...................T.....G..A...................T.....A.....A.................G...........G.....G.G.T................C....A.A............................AGG...........A.G.       26     26 ,     26     26     218:>KF789571,A/Alabama/07/2013(H3N2)                      
                   219 >KF789550,A/Nevada/04/2013(H3N2)                       ................T........G...C..A.T.........C...T...................T.....G..A...................T.....A.....A.........C.......G...........G.....G...T................C....A.A............................AGG...........A.G.       30     26 ,     30     26     219:>KF789550,A/Nevada/04/2013(H3N2)                       
                   220 >KF789579,A/Indiana/164/2012(H3N2)                     ................T........G...C..A.T.............T...................T.....G..A...................T.....A.....A.........G.......G...........G.....G...T................C....A.A......................A.....AGG...........A.G.       26     26 ,     26     26     220:>KF789579,A/Indiana/164/2012(H3N2)                     
                   221 >KF790244,A/Indiana/162/2012(H3N2)                     ................T........G...C..A.T.............T...................T.....G..A...................T.....A.....A.........G.......G...........G.....G...T................C....A.A......................A.....AGG...........A.G.       28     26 ,     28     26     221:>KF790244,A/Indiana/162/2012(H3N2)                     
                   222 >KF790205,A/Colorado/18/2012(H3N2)                     ..........T.....T........G...C..A.T.............T...................T.....G..A.............T.....T.....A.....A.................G...........G.........T................C....A...............A..............AGG...........A.G.       26     25 ,     26     25     222:>KF790205,A/Colorado/18/2012(H3N2)                     
                   223 >KF790104,A/Colorado/18/2012(H3N2)                     ..........T.....T........G...C..A.T.............T...................T.....G..A...................T.....A.....A.................G...........G.........T................C....A...............A..............AGG...........A.G.       24     24 ,     24     24     223:>KF790104,A/Colorado/18/2012(H3N2)                     
                   224 >KF789582,A/North Carolina/24/2012(H3N2)               ................T........G...C..A.T.............T...................T.....G..A...................T.....A.....A.................G...........G..........................C....A..............................AGG.............G.       22     20 ,     22     20     224:>KF789582,A/North Carolina/24/2012(H3N2)               
                   225 >KF790452,A/South Dakota/01/2013(H3N2)                 ..A.............T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G...........G..........................C....A.........T....................AGG...T......A..GA       26     26 ,     26     26     225:>KF790452,A/South Dakota/01/2013(H3N2)                 
                   226 >KF789923,A/North Dakota/08/2012(H3N2)                 ..A.............T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G...........G..........................C....A.........T....................AGG...T..........A       25     24 ,     25     24     226:>KF789923,A/North Dakota/08/2012(H3N2)                 
                   227 >KF790135,A/New York/03/2013(H3N2)                     ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G...........G..........................C....A.........T....................AGG...T...........       22     22 ,     22     22     227:>KF790135,A/New York/03/2013(H3N2)                     
                   228 >KF789769,A/Ohio/102/2012(H3N2)                        ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G...........G..........................C....A.........T....................AGG...T.........G.       24     23 ,     24     23     228:>KF789769,A/Ohio/102/2012(H3N2)                        
                   229 >KF789546,A/California/13/2013(H3N2)                   ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G...........G..........................C....A.........T....................AG....T.........G.       22     22 ,     22     22     229:>KF789546,A/California/13/2013(H3N2)                   
                   230 >KF789689,A/Nebraska/11/2012(H3N2)                     ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G...........G..........................C....A.........T....................AGG...T.........G.       23     23 ,     23     23     230:>KF789689,A/Nebraska/11/2012(H3N2)                     
                   231 >KF789722,A/Ohio/97/2012(H3N2)                         ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.....A...........G...........G..........................C....A.........T....................AGG...T.........G.       25     24 ,     25     24     231:>KF789722,A/Ohio/97/2012(H3N2)                         
                   232 >KF789709,A/Missouri/04/2013(H3N2)                     ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.....A...........G...........G..........................C....A.........T....................AGG...T.........G.       24     24 ,     24     24     232:>KF789709,A/Missouri/04/2013(H3N2)                     
                   233 >KF789605,A/West Virginia/20/2012(H3N2)                ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.....A...........G...........G..........................C....A.........T.C..................AGG...T.........G.       25     25 ,     25     25     233:>KF789605,A/West Virginia/20/2012(H3N2)                
                   234 >KF790125,A/Missouri/04/2013(H3N2)                     ................T........G......A.T.......T.....T...................TT....G..A..........A......C.T.....A.....A.....A...........G...........G..........................C....A.........T....................AGG...T.........G.       26     26 ,     26     26     234:>KF790125,A/Missouri/04/2013(H3N2)                     
                   235 >KF789728,A/North Carolina/05/2013(H3N2)               ................T........G......A.T.......T.....T...................TT....G..A..........A........T.....A.....AG................G...........G...............A..........C....A.........T....................AGG...T.........G.       29     26 ,     29     26     235:>KF789728,A/North Carolina/05/2013(H3N2)               
                   236 >KF790323,A/New Mexico/23/2012(H3N2)                   ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....AG................G...........G..........................C....A.........T....................AGG...T.........G.       26     24 ,     26     24     236:>KF790323,A/New Mexico/23/2012(H3N2)                   
                   237 >KF790190,A/Michigan/25/2012(H3N2)                     ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....AG................G...........G..........................C....A.........T....................AGG...T.........G.       24     24 ,     24     24     237:>KF790190,A/Michigan/25/2012(H3N2)                     
                   238 >KF789732,A/Vermont/19/2012(H3N2)                      ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G...........G..........................C....A.........T....................AGG...T.........G.       23     23 ,     23     23     238:>KF789732,A/Vermont/19/2012(H3N2)                      
                   239 >KF789646,A/Idaho/02/2013(H3N2)                        ................T........G......A.T.......T.....T..............A....T.....G..A..........A........T.....A.....A.................G...........G..........................C....A.........T....................AGG...T.........G.       25     24 ,     25     24     239:>KF789646,A/Idaho/02/2013(H3N2)                        
                   240 >KF790054,A/California/46/2012(H3N2)                   ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G...........G..........................C....A.........T....................AGG...T.........G.       23     23 ,     23     23     240:>KF790054,A/California/46/2012(H3N2)                   
                   241 >KF790454,A/Nevada/02/2013(H3N2)                       ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G...........G..........................C....A.........T....................AGG...T.........G.       25     23 ,     25     23     241:>KF790454,A/Nevada/02/2013(H3N2)                       
                   242 >KF789953,A/Ohio/01/2013(H3N2)                         ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G...........G..........................C....A.........T....................AGG...T.........G.       23     23 ,     23     23     242:>KF789953,A/Ohio/01/2013(H3N2)                         
                   243 >KF790509,A/California/11/2013(H3N2)                   ................T........G......A.T.......T.....T...................T.....G..A..........A........T...C.A.....A.................G...........G..........................C....A.........T....................AGG...T.........G.       26     24 ,     26     24     243:>KF790509,A/California/11/2013(H3N2)                   
                   244 >KF790213,A/Iowa/13/2012(H3N2)                         ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G...........G..........................C....A.........T....................AGG...T.........G.       23     23 ,     23     23     244:>KF790213,A/Iowa/13/2012(H3N2)                         
                   245 >KF790512,A/Idaho/01/2013(H3N2)                        ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G...........G..........................C....A.........T....................AGG.T.T.........G.       25     24 ,     25     24     245:>KF790512,A/Idaho/01/2013(H3N2)                        
                   246 >KF789826,A/Washington/62/2012(H3N2)                   ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G...........G..........................C....A.........T....................AGG...T.........G.       23     23 ,     23     23     246:>KF789826,A/Washington/62/2012(H3N2)                   
                   247 >KF790446,A/Wyoming/20/2012(H3N2)                      ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G.....A.....G..........................C....A.........T....................AGG...T.........G.       24     24 ,     24     24     247:>KF790446,A/Wyoming/20/2012(H3N2)                      
                   248 >KF789775,A/South Dakota/12/2012(H3N2)                 ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G.....A.....G..........................C....A.........T....................AGG...T.........G.       24     24 ,     24     24     248:>KF789775,A/South Dakota/12/2012(H3N2)                 
                   249 >KF789688,A/South Dakota/10/2012(H3N2)                 ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G.....A.....G..........................C....A.........T....................AGG...T.........G.       24     24 ,     24     24     249:>KF789688,A/South Dakota/10/2012(H3N2)                 
                   250 >KF789791,A/South Dakota/14/2012(H3N2)                 ................T........G......A.T.......T.....T...................T.....G..A..........A........T.....A.....A.................G.....A.....G..........................C....A.........T....................AGG...T.........G.       24     24 ,     24     24     250:>KF789791,A/South Dakota/14/2012(H3N2)                 
                   251 >KF789794,A/South Dakota/12/2012(H3N2)                 ................T........G......A.T.......T.....T...................T.....G..A..........A..T.....T.....A.....A........G........G.....A.....G..........................C....A.........T....................AGG...T.........G.       26     26 ,     26     26     251:>KF789794,A/South Dakota/12/2012(H3N2)                 
                   252 >KF790051,A/South Dakota/15/2012(H3N2)                 ................T........G......A.T.......T.....T...................T........A..........A..T.....T.....AA....A.................G.....A.....G..........................C....A.........T....................AGG...T.........G.       25     25 ,     25     25     252:>KF790051,A/South Dakota/15/2012(H3N2)                 
                   253 >KF790373,A/Ohio/01/2013(H3N2)                         ................T........G......A.T.......T.....T...................T.....G..A.A........A..T.....T.....A.....A.......M.........G...........G..........................C....A.........T....................AGG...T.........G.       26     26 ,     26     26     253:>KF790373,A/Ohio/01/2013(H3N2)                         
                   254 >KF790009,A/South Dakota/16/2012(H3N2)                 ................T........G......A.T.......T.....T...................T.....G..A.M........A..T.R...T.....A.....A........R........G...........G..........................C....A.........T....................AGG...T.........G.       27     27 ,     27     27     254:>KF790009,A/South Dakota/16/2012(H3N2)                 
                   255 >KF790141,A/Georgia/03/2013(H3N2)                      ................T........G......A.T.............T...................T.....G..A.............T.....T.....A.A...A........M........G...........G..C.......................C....A.................A........A...AGG.............G.       25     25 ,     25     25     255:>KF790141,A/Georgia/03/2013(H3N2)                      
                   256 >KF789884,A/Georgia/03/2013(H3N2)                      ................T........G......A.T.............T...................T.....G..A...................T.....A.A...A.................G...........G..C.......................C....A.................A........A...AGG.............G.       23     23 ,     23     23     256:>KF789884,A/Georgia/03/2013(H3N2)                      
                   257 >KF790115,A/Kansas/04/2013(H3N2)                       ................T........G......A.T.............T...................T.....G..A..............A....T.....A.....AR................G...........G..C........A.A............C....A........................T.A...AGG.............G.       28     26 ,     28     26     257:>KF790115,A/Kansas/04/2013(H3N2)                       
                   258 >KF790023,A/New Mexico/09/2013(H3N2)                   ................T........G......A.T.............T...................T.....G..A..............A....T.....A.....AG................G...........G..........................C....A..........................A...AGG.............G.       22     22 ,     22     22     258:>KF790023,A/New Mexico/09/2013(H3N2)                   
                   259 >KF790333,A/District Of Columbia/01/2012(H3N2)         ................T........G......A.T.............T...................T........A............A......T.....A.....A.................G...........G..........A.........C.....C....A.........................GA...AGG..A..........G.       25     24 ,     25     24     259:>KF790333,A/District Of Columbia/01/2012(H3N2)         
                   260 >KF789759,A/Nevada/28/2012(H3N2)                       ................T........G......A.T.....T.......T...................T.....G..AC...........A......T.....A.....A...............C.G...........G..........A.......A.C....CC....A.........................GA...AGG..A..........G.       31     30 ,     31     30     260:>KF789759,A/Nevada/28/2012(H3N2)                       
                   261 >KF790455,A/California/10/2013(H3N2)                   ................T........G......A.T.....T.......T...................T.....G..A............A......T.....A.....A......G..........G...........G........C.A.........C.....C....A.........................GA...AGG..A..........G.       30     28 ,     30     28     261:>KF790455,A/California/10/2013(H3N2)                   
                   262 >KF790066,A/Colorado/01/2013(H3N2)                     ................T........G......A.T.....T.......T...................T.....G..A............A......T.....A.....A.....A...........G...........G..........A.........C.....C....A.........................GA...AGG..A..........G.       27     27 ,     27     27     262:>KF790066,A/Colorado/01/2013(H3N2)                     
                   263 >KF789716,A/Colorado/21/2012(H3N2)                     ................T........G......A.T.....T.......T...................T.....G.GA............A......T.....A.....AR....A...........G...........G..........A.........C.....C....A...............A..........A...AGG.............G.       28     28 ,     28     28     263:>KF789716,A/Colorado/21/2012(H3N2)                     
                   264 >KF789812,A/Illinois/15/2012(H3N2)                     ................T........G......A.T.....T.......T...................T.....G..A............A......T.....A.....AG................G...........G..........A.........C.....C....A..........................A...AGG.............G.       25     25 ,     25     25     264:>KF789812,A/Illinois/15/2012(H3N2)                     
                   265 >KF790230,A/North Dakota/05/2012(H3N2)                 ................T........G......A.T.....T.......T...................T.....G..A............A......T.....A.....AG................G...........G..........A.........C.....C....A..........................A...AGG...............       24     24 ,     24     24     265:>KF790230,A/North Dakota/05/2012(H3N2)                 
                   266 >KF789640,A/Vermont/02/2013(H3N2)                      ................T........G......A.T.....T.......T...................T.....G..A............A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       24     24 ,     24     24     266:>KF789640,A/Vermont/02/2013(H3N2)                      
                   267 >KF790368,A/Ohio/92/2012(H3N2)                         ................T........G......A.T.....T.......T.......A...........T.....G..A............A......T.....A.....A..........A......G...........G..........A.........C.....C....A..........................A...AGG.............G.       26     26 ,     26     26     267:>KF790368,A/Ohio/92/2012(H3N2)                         
                   268 >KF789656,A/Oregon/01/2013(H3N2)                       ................T........G......A.T.....T.......T...................T.....G..A............A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       24     24 ,     24     24     268:>KF789656,A/Oregon/01/2013(H3N2)                       
                   269 >KF790028,A/Michigan/03/2013(H3N2)                     ................T........G......A.T.....T.......T...................T..G..G..A............A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       26     25 ,     26     25     269:>KF790028,A/Michigan/03/2013(H3N2)                     
                   270 >KF789740,A/Minnesota/03/2013(H3N2)                    ................T........G......A.T.....T.......T..........G........T.....G..A............A......T.....A.....A.................G...........G..........A.........C..C..C....A..........................A...AGG.............G.       26     26 ,     26     26     270:>KF789740,A/Minnesota/03/2013(H3N2)                    
                   271 >KF790473,A/New Mexico/04/2013(H3N2)                   ................TT.......G......A.T.....T.......T...................T.....G..A............A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       26     25 ,     26     25     271:>KF790473,A/New Mexico/04/2013(H3N2)                   
                   272 >KF789628,A/Kansas/02/2013(H3N2)                       ................T........G......A.T.....T.......T...................T.....G..A.......T....A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       26     25 ,     26     25     272:>KF789628,A/Kansas/02/2013(H3N2)                       
                   273 >KF789952,A/Illinois/01/2013(H3N2)                     ................T........G......A.T.....T.......T...................T.....G..A............A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       26     24 ,     26     24     273:>KF789952,A/Illinois/01/2013(H3N2)                     
                   274 >KF790357,A/Mississippi/01/2013(H3N2)                  ................T........G......A.T.....T.......T......A............T.....G..A............A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       25     25 ,     25     25     274:>KF790357,A/Mississippi/01/2013(H3N2)                  
                   275 >KF790334,A/Pennsylvania/02/2013(H3N2)                 ................T........G......A.T.....T.......T...................T.....G..A.....G......A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       25     25 ,     25     25     275:>KF790334,A/Pennsylvania/02/2013(H3N2)                 
                   276 >KF790478,A/Louisiana/01/2013(H3N2)                    ................T........G......A.T.....T.......T...................T.....G..A............A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       25     24 ,     25     24     276:>KF790478,A/Louisiana/01/2013(H3N2)                    
                   277 >KF789906,A/California/14/2013(H3N2)                   ................T........G......A.T.....T.......T...................T.....G..A............A......T.....A.....A.................G...........G.G........A.........C.....C....A..........................A...AGG.............G.       25     25 ,     25     25     277:>KF789906,A/California/14/2013(H3N2)                   
                   278 >KF790439,A/Wisconsin/41/2012(H3N2)                    ................T........G.....AA.T.....T.......T...................T.....G..A............A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       25     25 ,     25     25     278:>KF790439,A/Wisconsin/41/2012(H3N2)                    
                   279 >KF790413,A/Wisconsin/05/2013(H3N2)                    ................T........G.....AA.T.....T.......T...................T.....G..A............A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       26     25 ,     26     25     279:>KF790413,A/Wisconsin/05/2013(H3N2)                    
                   280 >KF789673,A/Missouri/13/2012(H3N2)                     ................T........G.....AA.T.....T.......T...................T.....G..A............A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       25     25 ,     25     25     280:>KF789673,A/Missouri/13/2012(H3N2)                     
                   281 >KF789619,A/Connecticut/01/2013(H3N2)                  ................T........G......A.T.....T.......T...................T.....G..A......A.....A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       25     25 ,     25     25     281:>KF789619,A/Connecticut/01/2013(H3N2)                  
                   282 >KF790160,A/Wisconsin/38/2012(H3N2)                    ................T........G......A.T.....T.......T...................T.....G..A............A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       24     24 ,     24     24     282:>KF790160,A/Wisconsin/38/2012(H3N2)                    
                   283 >KF789977,A/Oregon/01/2013(H3N2)                       ................T........G......A.T.....T.......T...................TT....G..A............A....C.T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       26     26 ,     26     26     283:>KF789977,A/Oregon/01/2013(H3N2)                       
                   284 >KF790041,A/Kansas/01/2013(H3N2)                       ................T........G......A.T.....T.......T...................T.....G..A............A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       24     24 ,     24     24     284:>KF790041,A/Kansas/01/2013(H3N2)                       
                   285 >KF789633,A/Louisiana/02/2013(H3N2)                    ................T........G......A.T.....T.......T...................T.....G..A............A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG..........T..G.       25     25 ,     25     25     285:>KF789633,A/Louisiana/02/2013(H3N2)                    
                   286 >KF789741,A/Tennessee/02/2013(H3N2)                    ................T........G......A.T.....T.......T...................T.....G..A............A......T.....A.....A.................G...........G..........A.........C.....C....A..........................A...AGG.............G.       24     24 ,     24     24     286:>KF789741,A/Tennessee/02/2013(H3N2)                    
                   287 >KF789885,A/Maine/11/2012(H3N2)                        ................T........G......A.T.....T.......T...................T.....G..A...................T.....A.....A.T...............G...........G..........A.G.......C.....C....A..........................A...AGG.............G.       25     25 ,     25     25     287:>KF789885,A/Maine/11/2012(H3N2)                        
                   288 >KF789650,A/Mississippi/02/2013(H3N2)                  ................T........G......A.T.....T.......T...................T.....G..A...................T.....A.....A.T...............G...........G..........A.G.......C.....C....A..........................A...AGG.............G.       25     25 ,     25     25     288:>KF789650,A/Mississippi/02/2013(H3N2)                  
                   289 >KF790517,A/California/12/2013(H3N2)                   C...............T........G......A.T.....T.......T...................T.....G..A...................T.....A.....A.T...............G...........G..........A.G.......C.....C....A..........................A...AGG.............G.       26     26 ,     26     26     289:>KF790517,A/California/12/2013(H3N2)                   
                   290 >KF789787,A/Michigan/32/2012(H3N2)                     ................T........G......A.T.....T.......T...................T.....G..A...................T.....A.....A.T...............G...........G..........A.G.......C.....C....A..........................A...AGG.............G.       25     25 ,     25     25     290:>KF789787,A/Michigan/32/2012(H3N2)                     
                   291 >KF790155,A/Minnesota/05/2013(H3N2)                    ................T........G......A.T..G..........T...................T.....G..A...................T.....A.....A.................G..........AG..........................C....A..........................A...AGG.............G.       25     22 ,     25     22     291:>KF790155,A/Minnesota/05/2013(H3N2)                    
                   292 >KF789739,A/California/22/2013(H3N2)                   ................T........G......A.T.............TC..................T.....G..A.....G.............T.....A.....A.................G...........G.................T........C....A.......................T..A...AGG.............G.       24     24 ,     24     24     292:>KF789739,A/California/22/2013(H3N2)                   
                   293 >KF790391,A/Alaska/04/2013(H3N2)                       ................T........G......A.T.............T...................T.....G..A...................T.....A.....A.................G...........G..........................C....A..........................A...AGG.............G.       22     20 ,     22     20     293:>KF790391,A/Alaska/04/2013(H3N2)                       
                   294 >KF790036,A/Nevada/05/2013(H3N2)                       ................T........G......A.T.............T...................T.....G..A...................T.....A.....A.................G...........G..........................C....A..........................A...AGG.............G.       20     20 ,     20     20     294:>KF790036,A/Nevada/05/2013(H3N2)                       
                   295 >KF790500,A/Kansas/11/2012(H3N2)                       ................T........G......A.T.............T.......A...........T.....G..A...................T.....A.....A.................G...........G..........................C....A..........................A...AGG.............G.       22     21 ,     22     21     295:>KF790500,A/Kansas/11/2012(H3N2)                       
                   296 >KF790100,A/Wyoming/18/2012(H3N2)                      ................T........G......A.T.............T...A...............T.....G..A...................T...........A.................G...........G..........................C....A..................A............GG.............G.       21     19 ,     21     19     296:>KF790100,A/Wyoming/18/2012(H3N2)                      
                   297 >KF789667,A/Maryland/30/2012(H3N2)                     ................T........G......A.T.................................T.....G..A..............T....T.....T.....A..T..............G...........G..........................C....A..................A.....................G.....G.       20     19 ,     20     19     297:>KF789667,A/Maryland/30/2012(H3N2)                     
                   298 >KF790432,A/Oregon/11/2012(H3N2)                       ....T...........T........G......A.T.................................T.....G..A...................T.....T.....A..T..............G...........G..........................C....A..................A.....................G.....G.       21     19 ,     21     19     298:>KF790432,A/Oregon/11/2012(H3N2)                       
                   299 >KF790229,A/Oklahoma/05/2012(H3N2)                     ....T...........T........G......A.T.................................T.....G..A...................T.....T.....A..T..............G...........G..........................C....A..................A.....................G.....G.       19     19 ,     19     19     299:>KF790229,A/Oklahoma/05/2012(H3N2)                     
                   300 >A/Czech Republic/121/2012,2012/03/06,Czech Republic   ................T........G......A.T......C.....................A....T........A...................T...........A.T...............G...........G..........................C....A..............................................G.       18     16 ,     18     16     300:>A/Czech Republic/121/2012,2012/03/06,Czech Republic   
                   301 >KF790228,A/Hawaii/30/2012(H3N2)                       ........A.......T........G......A.T.................................T........A..C................T........T..A.................G...........G.............A..C.........C...TA..............................................G.       19     19 ,     19     19     301:>KF790228,A/Hawaii/30/2012(H3N2)                       
                   302 >KF790430,A/Massachusetts/07/2012(H3N2)                ........A.......T........G......A.T.................................T........A..C................T........S..AR................G...........G.........T...A..C.........C...TA..............................................G.       23     21 ,     23     21     302:>KF790430,A/Massachusetts/07/2012(H3N2)                
                   303 >KF790502,A/Pennsylvania/21/2012(H3N2)                 ........A.......T........G......A.T.................................T........A..C................T...........A.................G..C........G.........T...A..C.........C...TA..............................................G.       20     20 ,     20     20     303:>KF790502,A/Pennsylvania/21/2012(H3N2)                 
                   304 >KF790461,A/New Mexico/03/2013(H3N2)                   ........A.......T........G......A.T.................................T........A..C................T.........Y.A.................G..C........G.........T...A..C.........C...TA..............................................G.       23     21 ,     23     21     304:>KF790461,A/New Mexico/03/2013(H3N2)                   
                   305 >KF790262,A/New Hampshire/12/2012(H3N2)                ........A.......T........G......A.T.................................T........A..C................T...........A.................G..C........G.........T...A..C.........C...TA..............................................G.       20     20 ,     20     20     305:>KF790262,A/New Hampshire/12/2012(H3N2)                
                   306 >KF789668,A/New Hampshire/11/2012(H3N2)                ........A.......T........G......A.T.................................T........A..C................T...........A.................G...........G.........T...A..C.........C...TA..............................................G.       19     19 ,     19     19     306:>KF789668,A/New Hampshire/11/2012(H3N2)                
                   307 >KF790236,A/New York/38/2012(H3N2)                     ........A.......T........G......A.T.................................T........A..C..............C.T...........A.................G...........G.........T...A..C.........C...TA..............................................G.       20     20 ,     20     20     307:>KF790236,A/New York/38/2012(H3N2)                     
                   308 >KF789870,A/New Hampshire/11/2012(H3N2)                ........A.......T........G......A.T.................................T........A..C..............C.T...........A.................G...........G.........T...A..C.........C...TA..............................................G.       20     20 ,     20     20     308:>KF789870,A/New Hampshire/11/2012(H3N2)                
                   309 >KF790282,A/New York/38/2012(H3N2)                     ........A.......T........G......A.T.................................T........A..C................T...........A.................G...........G.........T...A..C.........C...TA..............................................G.       19     19 ,     19     19     309:>KF790282,A/New York/38/2012(H3N2)                     
                   310 >KF789989,A/Hawaii/26/2012(H3N2)                       ........A.......T........G......A.T.................................T........A..C................T...........A.................G...........G.............A..C.........C...TA..............................................G.       18     18 ,     18     18     310:>KF789989,A/Hawaii/26/2012(H3N2)                       
                   311 >KF790171,A/Hawaii/28/2012(H3N2)                       ........A.......T........G......A.T.................................T........A..C................T...........A.................G...........G.............A..C.........C...TA..............................................G.       19     18 ,     19     18     311:>KF790171,A/Hawaii/28/2012(H3N2)                       
                   312 >KF789941,A/Hawaii/45/2012(H3N2)                       ........A.......T........G......A.T.................................T........A..C................T...........A.................G...........G.............A..C.........C...TA..............................................G.       18     18 ,     18     18     312:>KF789941,A/Hawaii/45/2012(H3N2)                       
                   313 >KF790223,A/Hawaii/29/2012(H3N2)                       ........A.......T........G......A.T.................................T........A..C................T...........A.................G...........G.............A..C.........C...TA..............................................G.       19     18 ,     19     18     313:>KF790223,A/Hawaii/29/2012(H3N2)                       
                   314 >KF789927,A/California/49/2012(H3N2)                   ........A.......T........G......A.T.................................T........A..C................T...........A.................G...........G.............A..C.........C...TA..............................................G.       18     18 ,     18     18     314:>KF789927,A/California/49/2012(H3N2)                   
                   315 >KF789990,A/Hawaii/25/2012(H3N2)                       ........A.......T........G......A.T...........................G.....T........A..C................T...........A.................G...........G.............A..C.........C...TA..............................................G.       19     19 ,     19     19     315:>KF789990,A/Hawaii/25/2012(H3N2)                       
                   316 >KF789993,A/Hawaii/25/2012(H3N2)                       ........A.......T........G......A.T...........................G.....T........A..C..........T.....T......T....A.................G...........G.............A..C.........C...TA..............................................G.       21     21 ,     21     21     316:>KF789993,A/Hawaii/25/2012(H3N2)                       
                   317 >KF789999,A/Hawaii/26/2012(H3N2)                       ........A.......T........G......A.T.................................T........A..C..........T.R...T......Y....A.................G...........G.............A..C.........C...TA..............................................G.       21     21 ,     21     21     317:>KF789999,A/Hawaii/26/2012(H3N2)                       
                   318 >KF789587,A/New Hampshire/16/2012(H3N2)                ................T........G......A.T.................................T........A.............T.....T...........A.................G...........G..........................C....A.....T............................T.......T...G.       20     17 ,     20     17     318:>KF789587,A/New Hampshire/16/2012(H3N2)                
                   319 >KF789696,A/Maine/05/2012(H3N2)                        .C...........A..T........G......A.T..........................G......T........A....G..............T...........A.................G...........G..........................C....A.......A...........................A..........G.       21     19 ,     21     19     319:>KF789696,A/Maine/05/2012(H3N2)                        
                   320 >KC893164,A/Maine/05/2012(H3N2)                        .C...........A..T........G......A.T..........................G......T........A....G..............T...........A.................G...........G..........................C....A.......A...........................A..........G.       19     19 ,     19     19     320:>KC893164,A/Maine/05/2012(H3N2)                        
                   321 >KF790394,A/New York/61/2012(H3N2)                     ......................................C...................................G......................T...........A.............................G.......................C..C.................................A......A..........G.       13     10 ,     13     10     321:>KF790394,A/New York/61/2012(H3N2)                     
                   322 >KF789877,A/Arkansas/05/2012(H3N2)                     .............A....A...T............CA................................K...GG.........A...............G........A................A...................................T...............T.A............C......A........G..........       18     18 ,     18     18     322:>KF789877,A/Arkansas/05/2012(H3N2)                     
                   323 >KF790184,A/Alaska/23/2012(H3N2)                       .............A........T.A..........CA..................................G.GG.........A......T........G........A........G.......A.........C................A........T.................A............C......A........G..........       21     21 ,     21     21     323:>KF790184,A/Alaska/23/2012(H3N2)                       
                   324 >KF790196,A/Alaska/22/2012(H3N2)                       .............A........T.A..........CA..................................G.GG.........A...............G........A................A.........C................A........T.................A............C......A........G..........       20     19 ,     20     19     324:>KF790196,A/Alaska/22/2012(H3N2)                       
                   325 >KF790195,A/Alaska/23/2012(H3N2)                       .............A........T.A..........CA..................................G.GG.........A...............G........A................A.........C................A........T.................A............C......A........G..........       19     19 ,     19     19     325:>KF790195,A/Alaska/23/2012(H3N2)                       
                   326 >KF789796,A/Alaska/31/2012(H3N2)                       .............A........T.A..........CA..................................G.GG.........A...............G........A................A.........C................A........T.................A............C......A........G..........       20     19 ,     20     19     326:>KF789796,A/Alaska/31/2012(H3N2)                       
                   327 >KF790255,A/Alaska/24/2012(H3N2)                       .............A........T.A..........CA..................................G.GG.........A...............G........A................A.........C................A........T.................A............C......A........G..........       19     19 ,     19     19     327:>KF790255,A/Alaska/24/2012(H3N2)                       
                   328 >KF790238,A/Alaska/24/2012(H3N2)                       .............A........T.A..........CA..................................G.GG.........A..........C....G........A................A.........C................A........T.................A............C......A........G..........       20     20 ,     20     20     328:>KF790238,A/Alaska/24/2012(H3N2)                       
                   329 >KF790216,A/Alaska/22/2012(H3N2)                       .............A........T.A..........CA..................................G.GG.........A..........C....G........A................A.........C................A........T.................A............C......A........G..........       20     20 ,     20     20     329:>KF790216,A/Alaska/22/2012(H3N2)                       
                   330 >KF789606,A/North Dakota/07/2012(H3N2)                 .............A........T............CA.....T..............................GG...C.....A...............G........A................A...................................T.....A...........A............C......A........G..........       19     18 ,     19     18     330:>KF789606,A/North Dakota/07/2012(H3N2)                 
                   331 >KF790370,A/Hawaii/27/2012(H3N2)                       .............A...........................................................GG.....C...A...............G........A............A...A.............T.......................................A............C......A........G.....T....       16     15 ,     16     15     331:>KF790370,A/Hawaii/27/2012(H3N2)                       
                   332 >KF790343,A/Hawaii/27/2012(H3N2)                       .............A...........................................................GG.....C...A......T........G........A.......M....A...A.............T.......................................A............C......A........G.....T....       17     17 ,     17     17     332:>KF790343,A/Hawaii/27/2012(H3N2)                       
                   333 >KF790425,A/Texas/83/2012(H3N2)                        ........A..C.............................................................GG........................TG........A...........A....A........T............................................A.........AA.C......A...................       16     15 ,     16     15     333:>KF790425,A/Texas/83/2012(H3N2)                        
                   334 >Index/32g12f1.c2,42-53                                ........A..C.............................................................GG........................TG........A...........A....A........T............................................A.........AA.C......A...................       15     15 ,     15     15     334:>Index/32g12f1.c2,42-53                                
                   335 >KF790187,A/Maryland/32/2012(H3N2)                     ...........C.............................................................GG........................TG........A................A........T............................................A.........AA.C......A...................       14     13 ,     14     13     335:>KF790187,A/Maryland/32/2012(H3N2)                     
                   336 >KF790185,A/Louisiana/09/2012(H3N2)                    ................................A........................................GG.........................G........A................A........T............................................A............C......A...................       15     10 ,     15     10     336:>KF790185,A/Louisiana/09/2012(H3N2)                    
                   337 >KF790227,A/Maine/08/2012(H3N2)                        .......................................................................G.GG.........................GC........................A........T............................................A...........TC......A...................       17     11 ,     17     11     337:>KF790227,A/Maine/08/2012(H3N2)                        
                                                                                                                                                                                                                                                                                                           
                  ---Index----------------------------------------------------TTGAAATCGTCTACTACGGTGACACAATTTGGGTCTGATGCTCCTTGCCTCGCTTGGGACGAAGCAACCGAAGAATAGTCTAAAGCTAGAGGGGTTAGTGATCGCTCCAGACCAAGAAATCGGGCTCTACTCAGCCTTGACATACATATCGGAGCGTAGATCATGTAGGACCAGTATCGCGCTTCACGTGGGCTCCGACAGCGAAGCGGAGTATCCCAAG 
                  -codon-position---------------------------------------------   11  1 1  11 1       1 2      212 12        2    111  11   212 1   1 1212     2        2 2 122 111 2  2 12 11  1   12 122     2    2     21 1 1        1   2   2    1                 1           1   1 1        2 12  2   
                                                                              0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000011111111111111111111111111111111111111111111111111111111111111111111111111111 
                                                                              0000000000000000000001111111111111112222222222222233333333334444444444444444455555555555556666666666666677777777777777788888888888999999999999900000000000111111111111122222222223333333333334444444444455555555555666666666 
                                                                              0122233334445557778990334445667888990011223477888901124556990111233456677789900111234466990001223448889900011122336668812333477889013456777889900111345888011123566799901345567892234456667891123445789900112455677112356778 
                                                                              9812836793582570284368594676251027155609287069125130685784035389005760823822814689870314163596399032790345904516262584569037303271359446258383459147276037103551867314508654795160384732351923687398451479384547958344732013





                  NA from H3N2, USA 2012f , all states


                  Code:
                                                                                                  000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 
                                                                                                  000000000000000000000000001111111111111111111111111122222222222222222222222222222222222233333333333333333333333344444444444444444444444444444555555555555555555566666666666666666666666666666777777777777777777777777788888888888888888888899999999999999999999999999990000000000000000000000000000000011111111111111111111111111111122222222222222222222222222333333333333333334444 
                                                                                                  011223345555667777888889990111122223345566677777788900000111112222233333344445566777788800011222333445677777888900012222334445555566667778889000011112444557888900111223334456666666777889999000111223344445556678888900122344445556667889900002233333334444566888999990000011112222233334445567788999900000111122344555666677888899900001223333444466777778999000013344556889990000 
                                                                                                  626578951789261278245783563178916790574658902457805202467036791235912457901245647038935803625147169686925689034926870679891361236934891246798145703692369259589139235790363780134569258140369058124032814572360370367229858706790271480781803671404567892359109136123560346812560367905781470921806257801467036918712578014845125827934798150369057803256891016245810547379360582356 
                  -codon-position-----------------------------------------------------------------  11 2    122 2 2 1 1 1 2 1  121 1 1  1   121 1 1 2 21 2    1 2 1 1 1 1 2 121 1    2 1          1  1 2   1 122   1    1  1 2212   12 1 1  1    1              1    1  2   121 1 12           1   1       1 2  11    1 122     1 1 2  1 2  1   1   12 12  1 1    2212 2 1121  112   1 1 2        1    2 2  2     2  12 2 2  1122   1 2 11   1    1 2     1 1  1  2   1    11  1  1212 
                  ---Index------------------------------------------------------------------------TTAAGTTCTAATGCTGTTACTGATCTTCATAGCACTCACGAAATAAGAAATGACGCCCCCAAAGAGAATCCCAACTGAAAGGAACAAATTGTGGTCGGCGGAACTCTGAAGCTCGAACGGTGCCTGATGCTAGACCAGTATTTCGGCGAGATTCTTGGGTATCTCGGGTAATAAGAATCCGCGGACTTCAATTAAAGGTAAAAATTACGGACGTTGACGCCTCATTGCAGCAACAGCCGAGTATTGTTCATGGAAAAAAGCCCAAGCTTTGATCTGAGTGTTAGACTAGGGAGTCGCGAGACAGACCGACCTAGCTATGGACGCGTAAGTTACTTAGAGCGCGGTGAAAAGTAACGGGCCTTTGGATCCCAT 
                     1 >Index/USA-2007                                                            ....................................................................................................................................................................................................................................................................................................................................................................................        0      0 ,      0      0       1:>Index/USA-2007                                                            
                     2 >Index/Brisbane-like/2007                                                  ....................................................................................................................................................................................................................................................................................................................................................................................        0      0 ,      0      0       2:>Index/Brisbane-like/2007                                                  
                     3 >Index/2009/Egypt/Iowa                                                     ................CC..C.........G..........................................................................................A............T...................................G................................................................................................................................A................................................G.......................        9      9 ,      9      9       3:>Index/2009/Egypt/Iowa                                                     
                     4 >Index/Perth-like/2009                                                     .......................................................................................G...............................A.A................................................G..............................................................A..........................................G.....G.........................................................................................        7      7 ,      7      7       4:>Index/Perth-like/2009                                                     
                     5 >KF765552,A/Texas/90/2009(H3N2))6 neuraminidase (NA) gene                  .......................................................................................G...............................A.A................................................G..............................................................A.............C............................G.....G.........................................................................................        8      8 ,      8      8       5:>KF765552,A/Texas/90/2009(H3N2))6 neuraminidase (NA) gene                  
                     6 >2007/02/06,14278,AUS,A/Brisbane/10/07                                     ...................................................................................................................................................................................................................................................C........................................................G.......................................................................        2      2 ,      2      2       6:>2007/02/06,14278,AUS,A/Brisbane/10/07                                     
                     7 >KF790044,A/Alaska/02/2013(H3N2))6 neuraminidase (NA) gene                 .C................................T...................A............G.......C......G............A...............T.........A.Y.R......................GR....................G............A..................................AT................T.............G...........A..............A........C........A..C..T..................G.....G....................T.................C......       29     29 ,     29     29       7:>KF790044,A/Alaska/02/2013(H3N2))6 neuraminidase (NA) gene                 
                     8 >KF790047,A/Alaska/02/2013(H3N2))6 neuraminidase (NA) gene                 .C................................T...................A............G.......C......G............A...............T.........A..........................G.....................G............A..................................AT................T.............G...........A..............A........C........A..C..T..................G.....G....................T.................C......       26     26 ,     26     26       8:>KF790047,A/Alaska/02/2013(H3N2))6 neuraminidase (NA) gene                 
                     9 >KF790218,A/South Carolina/16/2012(H3N2))6 neuraminidase (NA) gene         ..................................T...................A....................C......G............................T.........A....R...........................................G............A...................................T................T.............G...........A.......................C........A..C..T..................G.....G....................T.................C......       21     21 ,     21     21       9:>KF790218,A/South Carolina/16/2012(H3N2))6 neuraminidase (NA) gene         
                    10 >KF789813,A/Georgia/22/2012(H3N2))6 neuraminidase (NA) gene                ..................................T...................A....................C......G............................T.........A....G...........................................G............A...................................T................T.............G...........A.......................C........A..C..T..................G.....G....................T.................C......       21     21 ,     21     21      10:>KF789813,A/Georgia/22/2012(H3N2))6 neuraminidase (NA) gene                
                    11 >KF789545,A/California/55/2012(H3N2))6 neuraminidase (NA) gene             ..................................T...................A....................C......G............................T.........A.Y..............................................G............A...................................T................T.............G...........A..........T............C........A..C..T..................G.....G....................T.................C......       22     22 ,     22     22      11:>KF789545,A/California/55/2012(H3N2))6 neuraminidase (NA) gene             
                    12 >KF789934,A/Florida/01/2013(H3N2))6 neuraminidase (NA) gene                ..................................T...................A....................C......G............................T.........A.T............................................G.G............A...................................T................T.............G...........A.......................C........A..C..T..................G.....G....................T.................C......       22     22 ,     22     22      12:>KF789934,A/Florida/01/2013(H3N2))6 neuraminidase (NA) gene                
                    13 >KF790272,A/Nevada/26/2012(H3N2))6 neuraminidase (NA) gene                 ...............................A......................A....................C......G............................T.........A................C...............................G............A...................................T................T.............G...........A.......................C........A..C..T..................G.....G....................T.................C......       21     21 ,     21     21      13:>KF790272,A/Nevada/26/2012(H3N2))6 neuraminidase (NA) gene                 
                    14 >Index/32g12f1.c2,55-62                                                    ......................................................A....................C......G............................T.........A................................................G................................................T................T.............G...................................C........A..C..T..................G.....G....................T.................C......       17     17 ,     17     17      14:>Index/32g12f1.c2,55-62                                                    
                    15 >KF790086,A/Delaware/23/2012(H3N2))6 neuraminidase (NA) gene               ....T.................................................A....................C......G............................T.........A...R............................................G................................................T...........G....T.............G................................R..C........A..C..T..................G.....G....................T.................C......       21     21 ,     21     21      15:>KF790086,A/Delaware/23/2012(H3N2))6 neuraminidase (NA) gene               
                    16 >KF790068,A/Delaware/23/2012(H3N2))6 neuraminidase (NA) gene               ....T.................................................A....................C......G............................T.........A................................................G................................................T...........G....T.............G...................................C........A..C..T..................G.....G....................T.................C......       19     19 ,     19     19      16:>KF790068,A/Delaware/23/2012(H3N2))6 neuraminidase (NA) gene               
                    17 >KF789580,A/Colorado/20/2012(H3N2))6 neuraminidase (NA) gene               ..................G...................................A....................C..G...G............................T.........A................................................G................................................T................T.............G...................................C........A..C..T..................G.....G....................T.................C......       19     19 ,     19     19      17:>KF789580,A/Colorado/20/2012(H3N2))6 neuraminidase (NA) gene               
                    18 >KF790253,A/New York/40/2012(H3N2))6 neuraminidase (NA) gene               ......................................................A....................C...................................T.........A................................................G................................................T................T.............A...................................C........A..C..T..........G.......G.....G....................T.................C......       17     17 ,     17     17      18:>KF790253,A/New York/40/2012(H3N2))6 neuraminidase (NA) gene               
                    19 >KF789911,A/Alabama/35/2012(H3N2))6 neuraminidase (NA) gene                ......................................................A....................C.....T.............................T.........A............................................A...G................................................T......A.........T.............G...................................C........A..C..T..................G.....G....................T.................C......       19     19 ,     19     19      19:>KF789911,A/Alabama/35/2012(H3N2))6 neuraminidase (NA) gene                
                    20 >KF789677,A/Virginia/14/2012(H3N2))6 neuraminidase (NA) gene               ......................................................A....................C.....T.............................T.........A....R.......................................A...G................................................T......A.........T.............G...................................C........A..C..T..................G.....G....................T.................C......       20     20 ,     20     20      20:>KF789677,A/Virginia/14/2012(H3N2))6 neuraminidase (NA) gene               
                    21 >KF789685,A/Maryland/43/2012(H3N2))6 neuraminidase (NA) gene               ................................................R.....A....................C.....T.............................T.........A....R.......................................A...G................................................T......A.........T.............G...................................C........A..C..T..................G.....G....................T.................C......       21     21 ,     21     21      21:>KF789685,A/Maryland/43/2012(H3N2))6 neuraminidase (NA) gene               
                    22 >KF790177,A/Vermont/16/2012(H3N2))6 neuraminidase (NA) gene                ......................................................A..............T.....C...................................T.........A....R...........................................G................................................T................T.............G...................................C........A..C..T............T.....G.....G....................T.....T...........C......       20     20 ,     20     20      22:>KF790177,A/Vermont/16/2012(H3N2))6 neuraminidase (NA) gene                
                    23 >KF790295,A/Mississippi/13/2012(H3N2))6 neuraminidase (NA) gene            ......................................................A....................C......G............................T.........A....R...........................................G................................................T................T.A...........G...............................G...C........A..C..T..................G.....G....................T.................C......       20     20 ,     20     20      23:>KF790295,A/Mississippi/13/2012(H3N2))6 neuraminidase (NA) gene            
                    24 >KF789924,A/Georgia/16/2012(H3N2))6 neuraminidase (NA) gene                ......................................................AT...................C...................................T.........A....R...........................................G................................................T................T.............G...................................C........A..C..T..................G.....G....................T.................C...T..       19     19 ,     19     19      24:>KF789924,A/Georgia/16/2012(H3N2))6 neuraminidase (NA) gene                
                    25 >KF789901,A/Georgia/15/2012(H3N2))6 neuraminidase (NA) gene                ......................................................AT...................C...................................T.........A...R............................................G................................................T................T.............G...................................C........A..C..T..................G.....G....................T.................C...T..       19     19 ,     19     19      25:>KF789901,A/Georgia/15/2012(H3N2))6 neuraminidase (NA) gene                
                    26 >KF789992,A/Florida/39/2012(H3N2))6 neuraminidase (NA) gene                ......................................................A....................C...................................T.........A...R............................................G................................................T................T.............G...................................CG.......A..C..T..................G.....G..C.................T.................C......       19     19 ,     19     19      26:>KF789992,A/Florida/39/2012(H3N2))6 neuraminidase (NA) gene                
                    27 >KF789779,A/Louisiana/16/2012(H3N2))6 neuraminidase (NA) gene              ......................................................A....................C...................................T.........A................................................G................................................T...G............T.............G...................................C........A..C..T..................G.....G....................T.................C......       17     17 ,     17     17      27:>KF789779,A/Louisiana/16/2012(H3N2))6 neuraminidase (NA) gene              
                    28 >KF790098,A/Wisconsin/37/2012(H3N2))6 neuraminidase (NA) gene              ......................................................A....T...............C...................................T.........A.T................................A.............G...................................G............T................T.............G...................................C........A..C..T..................G.....G....................T.................C......       20     20 ,     20     20      28:>KF790098,A/Wisconsin/37/2012(H3N2))6 neuraminidase (NA) gene              
                    29 >KF790105,A/Mississippi/12/2012(H3N2))6 neuraminidase (NA) gene            ......................................................A....T...............C...................................T.........A.Y................................A.............G...................................G............T................T.............G...................................C........A..C..T..................G.....G....................T.................C......       20     20 ,     20     20      29:>KF790105,A/Mississippi/12/2012(H3N2))6 neuraminidase (NA) gene            
                    30 >KF790417,A/Nebraska/04/2013(H3N2))6 neuraminidase (NA) gene               ......................................................A....T...............C...................................T.........A..................................A.............G...................................G............T................T.............G...................................C........A..C..T..................G.....G....................T.................C......       19     19 ,     19     19      30:>KF790417,A/Nebraska/04/2013(H3N2))6 neuraminidase (NA) gene               
                    31 >KF790161,A/Oklahoma/04/2012(H3N2))6 neuraminidase (NA) gene               .....................................G...................................................................T........A......A..........T.................................A...G......................G............G............T....C.................G.................A....................C.............A..C..T.............................................T.........T.......C......       20     20 ,     20     20      31:>KF790161,A/Oklahoma/04/2012(H3N2))6 neuraminidase (NA) gene               
                    32 >KF790288,A/Maine/08/2012(H3N2))6 neuraminidase (NA) gene                  C...........................G.G..........................................................................................A................................................G....C.................GG........................T........................................A...G.............C................A..C............G.........................GA........T.................C....G.       20     20 ,     20     20      32:>KF790288,A/Maine/08/2012(H3N2))6 neuraminidase (NA) gene                  
                    33 >KF790173,A/Louisiana/09/2012(H3N2))6 neuraminidase (NA) gene              C.................................................................................G......................................A....R...........................................G....C.................GG................T.......T............................................G..................A...........A..C............G.A....A..................GA........T.................C....G.       22     22 ,     22     22      33:>KF790173,A/Louisiana/09/2012(H3N2))6 neuraminidase (NA) gene              
                    34 >Index/32g12f1.c2,42-53                                                    C.....................................................A..................................................................A.......T..................G.....................G....C.................GG........................T............................................G..................A...........A..C............G..........................A........TG................C......       19     19 ,     19     19      34:>Index/32g12f1.c2,42-53                                                    
                    35 >KF790498,A/Texas/83/2012(H3N2))6 neuraminidase (NA) gene                  C..........................................C..........A..................................................................A...R...T..................G.....................G..G.C.................GG........................T............................................G..................A...........A..C............G..........................A........TG................C......       22     22 ,     22     22      35:>KF790498,A/Texas/83/2012(H3N2))6 neuraminidase (NA) gene                  
                    36 >KF790182,A/Maryland/32/2012(H3N2))6 neuraminidase (NA) gene               C........................................................................................................................A.M.....T.................A......................G....C.................GG........................T............................................G.....A............A...........A..C............G.........................GA........TG................C......       21     21 ,     21     21      36:>KF790182,A/Maryland/32/2012(H3N2))6 neuraminidase (NA) gene               
                    37 >KF790206,A/Hawaii/27/2012(H3N2))6 neuraminidase (NA) gene                 C.......................................................................G..............................T.................A.T.............................................GG....C.................GT........................T............G.......A.............T...........A................A...........A..C....................A.................GA........T.......A.........C......       24     24 ,     24     24      37:>KF790206,A/Hawaii/27/2012(H3N2))6 neuraminidase (NA) gene                 
                    38 >KF790207,A/Hawaii/27/2012(H3N2))6 neuraminidase (NA) gene                 C.......................................................................G..............................T.................A...............................................GG....C.................GT........................T............G.......A.............T...........A................A....R......A..C....................A.................GA........T.......A.........C......       24     24 ,     24     24      38:>KF790207,A/Hawaii/27/2012(H3N2))6 neuraminidase (NA) gene                 
                    39 >KF790271,A/Alaska/24/2012(H3N2))6 neuraminidase (NA) gene                 C........................................................................................................................A................................................G....C.................GT........................T............G.................................A......T.........A...........A..C......................................GA........T.......A.........C......       18     18 ,     18     18      39:>KF790271,A/Alaska/24/2012(H3N2))6 neuraminidase (NA) gene                 
                    40 >KF790176,A/Alaska/22/2012(H3N2))6 neuraminidase (NA) gene                 C........................................................................................................................A................................................G....C.................GT........................T............G.................................A......T.........A...........A..C......................................GA........T.......A.........C......       18     18 ,     18     18      40:>KF790176,A/Alaska/22/2012(H3N2))6 neuraminidase (NA) gene                 
                    41 >KF790189,A/Alaska/23/2012(H3N2))6 neuraminidase (NA) gene                 C........................................................................................................................A................................................G....C.................GT........................T............G.................................A......T.........A...........A..C......................................GA........T.......A.........CA.....       19     19 ,     19     19      41:>KF790189,A/Alaska/23/2012(H3N2))6 neuraminidase (NA) gene                 
                    42 >KF790202,A/Alaska/23/2012(H3N2))6 neuraminidase (NA) gene                 C........................................................................................................................A....R...........................................G....C.................GT........................T............G.................................A......T.........A...........A..C......................................GA........T.......A.........CA.....       20     20 ,     20     20      42:>KF790202,A/Alaska/23/2012(H3N2))6 neuraminidase (NA) gene                 
                    43 >KF790226,A/Alaska/24/2012(H3N2))6 neuraminidase (NA) gene                 C........................................................................................................................A....R...........................................G....C.................GT........................T............G.................................A......T.........A...........A..C......................................GA........T.......A.........C......       19     19 ,     19     19      43:>KF790226,A/Alaska/24/2012(H3N2))6 neuraminidase (NA) gene                 
                    44 >KF789801,A/Alaska/31/2012(H3N2))6 neuraminidase (NA) gene                 C........................................................................................................................A....R...........................................G....C.................GT........................T............G.................................A......T.........A...........A..C......................................GA........T.......A.........C......       19     19 ,     19     19      44:>KF789801,A/Alaska/31/2012(H3N2))6 neuraminidase (NA) gene                 
                    45 >KF789575,A/North Dakota/07/2012(H3N2))6 neuraminidase (NA) gene           C...........K............................................................................................................A....R...........................................G....C.................GT........................T............G.................................A......T.........A...........AT.C......................................GA........T.......A.........C......       21     21 ,     21     21      45:>KF789575,A/North Dakota/07/2012(H3N2))6 neuraminidase (NA) gene           
                    46 >KF789886,A/Arkansas/05/2012(H3N2))6 neuraminidase (NA) gene               C...................................................................A....................................................A...RR...........................................G....C.................GT........................T............G.................................A......T.........A...........A..C......................................GA........T.......A.........C......       21     21 ,     21     21      46:>KF789886,A/Arkansas/05/2012(H3N2))6 neuraminidase (NA) gene               
                    47 >KF790198,A/Alaska/22/2012(H3N2))6 neuraminidase (NA) gene                 C........................................................................................................................A...R............................................G....C.................GT........................T............G.................................A......T.........A...........A..C......................................GA........T.......A.........C......       19     19 ,     19     19      47:>KF790198,A/Alaska/22/2012(H3N2))6 neuraminidase (NA) gene                 
                    48 >KF790392,A/New York/61/2012(H3N2))6 neuraminidase (NA) gene               C...............C.................................C...............................................A......................A................................................G....C.................GT............T...........T............G.................................A......T.........A...........A..C......................................GA........T...A...A.........C..T...       24     24 ,     24     24      48:>KF790392,A/New York/61/2012(H3N2))6 neuraminidase (NA) gene               
                    49 >KF790435,A/Louisiana/11/2012(H3N2))6 neuraminidase (NA) gene              ................C......C.........G.......................................................................................A..........................G.....................G.....................C............C.............T....................................G..........................A...........A..C..T.............................................T.................C.....C       17     17 ,     17     17      49:>KF790435,A/Louisiana/11/2012(H3N2))6 neuraminidase (NA) gene              
                    50 >Index/H3N3-2011-reassortedEI/2011(H3N2)                                   .........................................................................................................................A................................................G................................................T...........................................................................A..C..T.............................................T.................C......        8      8 ,      8      8      50:>Index/H3N3-2011-reassortedEI/2011(H3N2)                                   
                    51 >KF789908,A/Florida/68/2012(H3N2))6 neuraminidase (NA) gene                .......................................................................................................T.................A.............................C..................G................C...............................T...........................................................................A..C..T........................G....................T.................C......       12     12 ,     12     12      51:>KF789908,A/Florida/68/2012(H3N2))6 neuraminidase (NA) gene                
                    52 >KF789902,A/Kentucky/24/2012(H3N2))6 neuraminidase (NA) gene               .....................................................................T.....C...........................T..............A..A.................G...........C.............A....G................C...........G...................T.....C...........................G.........................................A..C..T.......................CG....................C.................C......       21     21 ,     21     21      52:>KF789902,A/Kentucky/24/2012(H3N2))6 neuraminidase (NA) gene               
                    53 >KF789603,A/Kentucky/17/2012(H3N2))6 neuraminidase (NA) gene               .....................................................................T.....C...........................T..............A..A....R............G...........C.............A....G................C...........G...................T.....C...........................G.........................................A..C..T.......................CG....................C.................C......       22     22 ,     22     22      53:>KF789603,A/Kentucky/17/2012(H3N2))6 neuraminidase (NA) gene               
                    54 >KF790513,A/Tennessee/10/2012(H3N2))6 neuraminidase (NA) gene              .....................................................................T.....C...........................T..............A..A....R............G...........C.............A....G................C...........G...................T.....C...........................G.........................................A..C..T.......................CG....................C.................C......       22     22 ,     22     22      54:>KF790513,A/Tennessee/10/2012(H3N2))6 neuraminidase (NA) gene              
                    55 >KF790487,A/South Carolina/22/2012(H3N2))6 neuraminidase (NA) gene         .....................................................................T.....C...........................T..............A..A.................G...........C.............A....G................C...........G...................T.....C...........................G...........R.............................A..C..T.......................CG....................C.................C......       22     22 ,     22     22      55:>KF790487,A/South Carolina/22/2012(H3N2))6 neuraminidase (NA) gene         
                    56 >KF789816,A/Virginia/16/2012(H3N2))6 neuraminidase (NA) gene               .....................................................................T.....C...........................T..............A..A.................G...........C.............A....G................C...........G.C.................T.....C...........................G.........................................A..C..T.....A.................CG....................C.................C......       23     23 ,     23     23      56:>KF789816,A/Virginia/16/2012(H3N2))6 neuraminidase (NA) gene               
                    57 >KF789809,A/Virginia/16/2012(H3N2))6 neuraminidase (NA) gene               .....................................................................T.....C...........................T....R.........A..A...R.............G...........C.............A....G................C...........G.C.................T.....C...........................G.........................................A..C..T.....A.................CG....................C.................C......       25     25 ,     25     25      57:>KF789809,A/Virginia/16/2012(H3N2))6 neuraminidase (NA) gene               
                    58 >KF789672,A/Virginia/15/2012(H3N2))6 neuraminidase (NA) gene               ................................................................R....T.....C...........................T..............A..A...R.............G...........C.............A....G................C...........G.C.................T.....C...........................G.........................................A..C..T.......................CG....................C.................C......       24     24 ,     24     24      58:>KF789672,A/Virginia/15/2012(H3N2))6 neuraminidase (NA) gene               
                    59 >KF789914,A/South Carolina/24/2012(H3N2))6 neuraminidase (NA) gene         .....................................................................T.....C...........................T..............A..A.Y.R.............G...........C.............A....G................C...........G...................T.....C...........................G.........................................A..C..T.......................CG....................C.................C......       23     23 ,     23     23      59:>KF789914,A/South Carolina/24/2012(H3N2))6 neuraminidase (NA) gene         
                    60 >KF789704,A/Kentucky/18/2012(H3N2))6 neuraminidase (NA) gene               .....................................................................T.....C...........................T..............A..A.................G...........C.............A....G................C...........G...................T.....C...........................G.........................................A..C..T.......................CG....................C............C....C......       22     22 ,     22     22      60:>KF789704,A/Kentucky/18/2012(H3N2))6 neuraminidase (NA) gene               
                    61 >KF789969,A/South Carolina/24/2012(H3N2))6 neuraminidase (NA) gene         ........................T............................................T.....C...........................T..............A..A.................G...........C.............A....G................C...........G...................T.....C...........................G.........................................A..C..T.......................CG....................C.................C......       22     22 ,     22     22      61:>KF789969,A/South Carolina/24/2012(H3N2))6 neuraminidase (NA) gene         
                    62 >KF789720,A/Tennessee/18/2012(H3N2))6 neuraminidase (NA) gene              .....................................................................T.....C...........................T..............A..A.................G...........C.............A....G................C...........G...................T.....C...........................G.........................................A..C..T.......................CG....................C.................C......       21     21 ,     21     21      62:>KF789720,A/Tennessee/18/2012(H3N2))6 neuraminidase (NA) gene              
                    63 >KF789760,A/Michigan/33/2012(H3N2))6 neuraminidase (NA) gene               .....................................................................T.....C...........................T..............A..A.................G...........C.............A....G................C...........G...................T.....C...........................G.........................................A..C..T.......................CG....................C.................C......       21     21 ,     21     21      63:>KF789760,A/Michigan/33/2012(H3N2))6 neuraminidase (NA) gene               
                    64 >A/Czech Republic/121/2012,2012/03/06,Czech Republic                       ...T.......................................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT........................................................................A..A..C...........................G....................T.................C......       19     19 ,     19     19      64:>A/Czech Republic/121/2012,2012/03/06,Czech Republic                       
                    65 >KF789595,A/New Hampshire/16/2012(H3N2))6 neuraminidase (NA) gene          ....................................T......................................C....A..G....C..........................C.....A............T....G..............................G.......T..................A.......C............AT......................G..A..............................................A..AT.C...........................G....................T.................C......       24     24 ,     24     24      65:>KF789595,A/New Hampshire/16/2012(H3N2))6 neuraminidase (NA) gene          
                    66 >KF789695,A/Maine/05/2012(H3N2))6 neuraminidase (NA) gene                  ...........................................................................C....A..G....C................................A............T....G..............................G.......T.A................A....................AT........................C...............................................A..A..C...........................G................A...T.................C......       21     21 ,     21     21      66:>KF789695,A/Maine/05/2012(H3N2))6 neuraminidase (NA) gene                  
                    67 >KC893168,A/Maine/05/2012(H3N2))6 neuraminidase (NA) gene                  ...........................................................................C....A..G....C................................A...R........T....G..............................G.......T.A................A....................AT........................C...............................................A..A..C...........................G................A...T.................C......       22     22 ,     22     22      67:>KC893168,A/Maine/05/2012(H3N2))6 neuraminidase (NA) gene                  
                    68 >KF790034,A/Oklahoma/08/2013(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C.A................A....A........A.Y.R........T....G..............................G.......T.A................A....................AT..............C......................C..................................A..A..C..........T................G...............A....T.................C......       28     28 ,     28     28      68:>KF790034,A/Oklahoma/08/2013(H3N2))6 neuraminidase (NA) gene               
                    69 >KF790220,A/Arizona/09/2012(H3N2))6 neuraminidase (NA) gene                ...........................................................................C....A..G....C................................A.Y..........T....G..............................G.......T..................A....................AT..............C...............................................G.........A..A..C..........T................G...............A....T.................C......       23     23 ,     23     23      69:>KF790220,A/Arizona/09/2012(H3N2))6 neuraminidase (NA) gene                
                    70 >KF790268,A/Arizona/09/2012(H3N2))6 neuraminidase (NA) gene                ...........................................................................C....A..G....C.............R..................A............T....G..............................G.......T..................A....................AT..............C...............................................G.........A..A..C..........T................G...............A....T.................C......       23     23 ,     23     23      70:>KF790268,A/Arizona/09/2012(H3N2))6 neuraminidase (NA) gene                
                    71 >KF790245,A/Indiana/161/2012(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C...............................................G.........A..A..C..........T................G...............A....T.................C......       23     23 ,     23     23      71:>KF790245,A/Indiana/161/2012(H3N2))6 neuraminidase (NA) gene               
                    72 >KF790344,A/New Mexico/05/2013(H3N2))6 neuraminidase (NA) gene             ...........................................................................C....A..G....C....A...........................A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       23     23 ,     23     23      72:>KF790344,A/New Mexico/05/2013(H3N2))6 neuraminidase (NA) gene             
                    73 >KF789778,A/Oregon/12/2012(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C....A..G....C................................A...R........T....G....A.........................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       23     23 ,     23     23      73:>KF789778,A/Oregon/12/2012(H3N2))6 neuraminidase (NA) gene                 
                    74 >KF789781,A/Kansas/14/2012(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C....A.GG....C................................A...R........T....G..............................G.......T..................A....................AT..............C.......................G.................................A..A..C..........T................G...............A....T.................C......       24     24 ,     24     24      74:>KF789781,A/Kansas/14/2012(H3N2))6 neuraminidase (NA) gene                 
                    75 >KF789921,A/Hawaii/24/2012(H3N2))6 neuraminidase (NA) gene                 ....................................................R......................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.G...............C......       24     24 ,     24     24      75:>KF789921,A/Hawaii/24/2012(H3N2))6 neuraminidase (NA) gene                 
                    76 >KF789542,A/Pennsylvania/03/2013(H3N2))6 neuraminidase (NA) gene           ...........................................................................C....A..G....C................................A..CR........T....G..............................G.......T..................A....................AT..............C...................................A.....................A..A..C..........T................G...............A....T.................C......       24     24 ,     24     24      76:>KF789542,A/Pennsylvania/03/2013(H3N2))6 neuraminidase (NA) gene           
                    77 >KF790004,A/New York/35/2012(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       22     22 ,     22     22      77:>KF790004,A/New York/35/2012(H3N2))6 neuraminidase (NA) gene               
                    78 >KF790085,A/Vermont/28/2012(H3N2))6 neuraminidase (NA) gene                ...........................................................................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       22     22 ,     22     22      78:>KF790085,A/Vermont/28/2012(H3N2))6 neuraminidase (NA) gene                
                    79 >KF790101,A/Delaware/10/2012(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       22     22 ,     22     22      79:>KF790101,A/Delaware/10/2012(H3N2))6 neuraminidase (NA) gene               
                    80 >KF790434,A/Delaware/11/2012(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T.........A......G...............A....T.................C......       23     23 ,     23     23      80:>KF790434,A/Delaware/11/2012(H3N2))6 neuraminidase (NA) gene               
                    81 >KF790170,A/Washington/52/2012(H3N2))6 neuraminidase (NA) gene             ...........................................................................C....A..G....C................................A...R........T....G......................................T..................A....................AT..............C.........................................................A..A..C..........T................G...........A...A....T.................C......       22     22 ,     22     22      81:>KF790170,A/Washington/52/2012(H3N2))6 neuraminidase (NA) gene             
                    82 >KF789621,A/Maryland/03/2013(H3N2))6 neuraminidase (NA) gene               ....A.....G................................................................C....A..G....C................................A............T....G..............................G.......T..................A...G..........A.....AT..............C.........................................................A..A..C..........T................G...........A...A....T.................C......       26     26 ,     26     26      82:>KF789621,A/Maryland/03/2013(H3N2))6 neuraminidase (NA) gene               
                    83 >KF790154,A/California/04/2013(H3N2))6 neuraminidase (NA) gene             ..C........................................................................C....A..G....C................................A............T....G......................T.......G.......T.....G............A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       24     24 ,     24     24      83:>KF790154,A/California/04/2013(H3N2))6 neuraminidase (NA) gene             
                    84 >KF789624,A/North Carolina/04/2013(H3N2))6 neuraminidase (NA) gene         .................A.........................................................C....A..G....C................................A............T....G..............................G.......T.......................................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       21     21 ,     21     21      84:>KF789624,A/North Carolina/04/2013(H3N2))6 neuraminidase (NA) gene         
                    85 >KF789711,A/Texas/91/2012(H3N2))6 neuraminidase (NA) gene                  ...........................................................................C....A..G....C................................A............T....G..W...........................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       22     22 ,     22     22      85:>KF789711,A/Texas/91/2012(H3N2))6 neuraminidase (NA) gene                  
                    86 >KF790193,A/Florida/40/2012(H3N2))6 neuraminidase (NA) gene                ..............................................A............................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       22     22 ,     22     22      86:>KF790193,A/Florida/40/2012(H3N2))6 neuraminidase (NA) gene                
                    87 >KF790243,A/California/42/2012(H3N2))6 neuraminidase (NA) gene             ...........................................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       21     21 ,     21     21      87:>KF790243,A/California/42/2012(H3N2))6 neuraminidase (NA) gene             
                    88 >Index/32g12f1.c2,10-37                                                    ...........................................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       21     21 ,     21     21      88:>Index/32g12f1.c2,10-37                                                    
                    89 >KF790075,A/Vermont/28/2012(H3N2))6 neuraminidase (NA) gene                ...........................................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       21     21 ,     21     21      89:>KF790075,A/Vermont/28/2012(H3N2))6 neuraminidase (NA) gene                
                    90 >KF789678,A/Rhode Island/09/2012(H3N2))6 neuraminidase (NA) gene           ...........................................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       21     21 ,     21     21      90:>KF789678,A/Rhode Island/09/2012(H3N2))6 neuraminidase (NA) gene           
                    91 >KF789850,A/Michigan/02/2013(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       21     21 ,     21     21      91:>KF789850,A/Michigan/02/2013(H3N2))6 neuraminidase (NA) gene               
                    92 >KF790445,A/Delaware/15/2012(H3N2))6 neuraminidase (NA) gene               .........................C.................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       22     22 ,     22     22      92:>KF790445,A/Delaware/15/2012(H3N2))6 neuraminidase (NA) gene               
                    93 >KF789918,A/Texas/01/2013(H3N2))6 neuraminidase (NA) gene                  ........................................G..................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       22     22 ,     22     22      93:>KF789918,A/Texas/01/2013(H3N2))6 neuraminidase (NA) gene                  
                    94 >KF790347,A/Utah/02/2013(H3N2))6 neuraminidase (NA) gene                   ........................................G..................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.......................C.................................A..A..C..........T................G...............A....T.................C......       23     23 ,     23     23      94:>KF790347,A/Utah/02/2013(H3N2))6 neuraminidase (NA) gene                   
                    95 >KF790377,A/Oklahoma/05/2013(H3N2))6 neuraminidase (NA) gene               ........................................G..................................C....A..G....C................................A............T.G..G..............................G.......T..................A..................T.AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       24     24 ,     24     24      95:>KF790377,A/Oklahoma/05/2013(H3N2))6 neuraminidase (NA) gene               
                    96 >KF790462,A/Oklahoma/05/2013(H3N2))6 neuraminidase (NA) gene               ........................................G..................................C....A..G....C................................A...R........T.G..G..............................G.......T..................A..................T.AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       25     25 ,     25     25      96:>KF790462,A/Oklahoma/05/2013(H3N2))6 neuraminidase (NA) gene               
                    97 >KF789554,A/California/15/2013(H3N2))6 neuraminidase (NA) gene             ...........................................................................C....A..G....C................................A...R........T....G............C.................G.......TT.................A....................AT..............C.........................................................A..A..C..........T................G...............A....T....C............C......       25     25 ,     25     25      97:>KF789554,A/California/15/2013(H3N2))6 neuraminidase (NA) gene             
                    98 >KF789719,A/Montana/14/2012(H3N2))6 neuraminidase (NA) gene                ...........................................................................C....A..G....C................................A............T....G........G.....................G.......TT.................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       23     23 ,     23     23      98:>KF789719,A/Montana/14/2012(H3N2))6 neuraminidase (NA) gene                
                    99 >KF790058,A/Delaware/01/2013(H3N2))6 neuraminidase (NA) gene               .........................................G.................................C....A..G....C................................A............T....G..............................G.......T...........G......A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       23     23 ,     23     23      99:>KF790058,A/Delaware/01/2013(H3N2))6 neuraminidase (NA) gene               
                   100 >KF789991,A/Montana/10/2012(H3N2))6 neuraminidase (NA) gene                .............................C...................................A.........C....A..G....C................................A....R.......T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       24     24 ,     24     24     100:>KF789991,A/Montana/10/2012(H3N2))6 neuraminidase (NA) gene                
                   101 >KF789570,A/Indiana/01/2013(H3N2))6 neuraminidase (NA) gene                ...........................................................................C....A..G....C................................A....R.......T....G..............................G.......T..................A....................AT..............C.................................C.......................A..A..C..........T................G...............A....T.................C......       23     23 ,     23     23     101:>KF789570,A/Indiana/01/2013(H3N2))6 neuraminidase (NA) gene                
                   102 >KF790057,A/Texas/111/2012(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C....A..G....C................................A....R.......T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C.....T....T................G...............A....T.................C......       23     23 ,     23     23     102:>KF790057,A/Texas/111/2012(H3N2))6 neuraminidase (NA) gene                 
                   103 >KF789984,A/Texas/81/2012(H3N2))6 neuraminidase (NA) gene                  ...........................................................................C....A..G....C................................A...RR.......T....G..............................G.......T..................A....................AT.C............C.........................................................A..A..C..........T................G...............A....T.................C......       24     24 ,     24     24     103:>KF789984,A/Texas/81/2012(H3N2))6 neuraminidase (NA) gene                  
                   104 >KF790112,A/Kentucky/16/2012(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C................................A....R.......T....G..............................G.......T..................A....................AT..............C....................................G....................A..A..C..........T................G...............A....T.................C......       23     23 ,     23     23     104:>KF790112,A/Kentucky/16/2012(H3N2))6 neuraminidase (NA) gene               
                   105 >KF790399,A/Florida/12/2013(H3N2))6 neuraminidase (NA) gene                ...........................T.................G........A....................C....A..G....C................................A............T....G..............................G.......T..................A....G...............AT..............C....................................G....................A..A..C..........T................G...............A....T.................C......       26     26 ,     26     26     105:>KF790399,A/Florida/12/2013(H3N2))6 neuraminidase (NA) gene                
                   106 >KF789609,A/Nebraska/06/2013(H3N2))6 neuraminidase (NA) gene               ..................................................C...A....M...............C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C....................................G....................A..A..C..........T................G...............A....T........A........C......       27     27 ,     27     27     106:>KF789609,A/Nebraska/06/2013(H3N2))6 neuraminidase (NA) gene               
                   107 >KF790371,A/Maryland/05/2013(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C................................A...R........T....G......T.......................G.......T..................A....................AT..............C............................C.......G....................A..A..C......A...T................G...............A....T.................C......       26     26 ,     26     26     107:>KF790371,A/Maryland/05/2013(H3N2))6 neuraminidase (NA) gene               
                   108 >KF790336,A/District Of Columbia/02/2012(H3N2))6 neuraminidase (NA) gene   ...........................................................................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C....................................G....................A..A..C......A...T................G...............A....T.................C......       24     24 ,     24     24     108:>KF790336,A/District Of Columbia/02/2012(H3N2))6 neuraminidase (NA) gene   
                   109 >KF789648,A/Alaska/06/2013(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C....A..G....C...A............................A...A........T....G.C............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T..............C..C......       25     25 ,     25     25     109:>KF789648,A/Alaska/06/2013(H3N2))6 neuraminidase (NA) gene                 
                   110 >KF790381,A/Alaska/05/2013(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C....A..G....C...A............................A...R........T....G.C............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G...............A....T.................C......       24     24 ,     24     24     110:>KF790381,A/Alaska/05/2013(H3N2))6 neuraminidase (NA) gene                 
                   111 >KF789750,A/Maryland/06/2013(H3N2))6 neuraminidase (NA) gene               .........................................T.................................C....A..G....C...A............................A...R........T....G..............................G....G..T..G......T........A.................A..AT..............C.........................................................A..A..C...........................G....................T.........A.....A.C......       28     28 ,     28     28     111:>KF789750,A/Maryland/06/2013(H3N2))6 neuraminidase (NA) gene               
                   112 >KF789866,A/Hawaii/02/2013(H3N2))6 neuraminidase (NA) gene                 .................................G.........................................C....A..G....C...A............................A...R........T....G..............................G.......T..................A...................TAT..............C...................................................C.....A..A..C...........................G....................T.................CC.....       25     25 ,     25     25     112:>KF789866,A/Hawaii/02/2013(H3N2))6 neuraminidase (NA) gene                 
                   113 >KF789972,A/West Virginia/01/2013(H3N2))6 neuraminidase (NA) gene          .................................G.........................................C....A..G....C................................A...R........T....G..............................G.......T..................A...................TAT..............C.........................................................A..A..C...........................G....................T......T..........CC.....       24     24 ,     24     24     113:>KF789972,A/West Virginia/01/2013(H3N2))6 neuraminidase (NA) gene          
                   114 >KF790472,A/Rhode Island/06/2013(H3N2))6 neuraminidase (NA) gene           .................................G.........................................C....A..G....C................................A...R........T....G..............................G.......T..................A...................TAT..............C.......................................C.................A..A..C...........................G....................T.................CC.....       24     24 ,     24     24     114:>KF790472,A/Rhode Island/06/2013(H3N2))6 neuraminidase (NA) gene           
                   115 >KF790163,A/New York/37/2012(H3N2))6 neuraminidase (NA) gene               .................................G.........................................C....A..G....C................................A............T....G..............................G.......T..................A...................TAT..............C.........................................................A..A..C...........................G....................T.................CC.....       22     22 ,     22     22     115:>KF790163,A/New York/37/2012(H3N2))6 neuraminidase (NA) gene               
                   116 >KF790264,A/Rhode Island/08/2012(H3N2))6 neuraminidase (NA) gene           .................................G.........................................C....A..G....C................................A............T....G..............................G.......T..................A...................TAT..............C.........................................................A..A..C...........................G....................T.................CC.....       22     22 ,     22     22     116:>KF790264,A/Rhode Island/08/2012(H3N2))6 neuraminidase (NA) gene           
                   117 >KF790292,A/New York/39/2012(H3N2))6 neuraminidase (NA) gene               .................................G.........................................C....A..G....C................................A............T....G..............................G.......T..................A...................TAT..............C.........................................................A..A..C...........................G....................T.................CC.....       22     22 ,     22     22     117:>KF790292,A/New York/39/2012(H3N2))6 neuraminidase (NA) gene               
                   118 >KF790222,A/New York/39/2012(H3N2))6 neuraminidase (NA) gene               .................................G.........................................C....A..G....C...........R....................A............T....G..............................G.......T..................A...................TAT..............C.........................................................A..A..C...........................G....................T.................CC.....       23     23 ,     23     23     118:>KF790222,A/New York/39/2012(H3N2))6 neuraminidase (NA) gene               
                   119 >KF789896,A/Kansas/16/2012(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C....A..G....C................................A........C...T....G..............................G.......T..................A....................AT.............YC.........................................................A..A..C...........................G....................T.................C......       21     21 ,     21     21     119:>KF789896,A/Kansas/16/2012(H3N2))6 neuraminidase (NA) gene                 
                   120 >KF789935,A/Wyoming/01/2013(H3N2))6 neuraminidase (NA) gene                ...........................................................................C....A..G....C................................A........C...T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     120:>KF789935,A/Wyoming/01/2013(H3N2))6 neuraminidase (NA) gene                
                   121 >KF789682,A/New Jersey/08/2012(H3N2))6 neuraminidase (NA) gene             ......C.C...........C......................................................C....A..G....CC................C..............A...R....C...T....G............C.................G.......T..........G.......A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       28     28 ,     28     28     121:>KF789682,A/New Jersey/08/2012(H3N2))6 neuraminidase (NA) gene             
                   122 >KF790237,A/Pennsylvania/20/2012(H3N2))6 neuraminidase (NA) gene           ...........................................................................C....A..G....C.................C..............A....R.......T....G..............................G.......T..........G.......A....................AT..............C.........................................................A..A..C...........................G........G...........T.................C......       23     23 ,     23     23     122:>KF790237,A/Pennsylvania/20/2012(H3N2))6 neuraminidase (NA) gene           
                   123 >KF790094,A/Wyoming/18/2012(H3N2))6 neuraminidase (NA) gene                ............................G..............................................C....A..G....C................................A....R.......T....G..............................G.......T..................A....................AT..............C.......................................C.................A..A..C............C..............G....................T.................C......       23     23 ,     23     23     123:>KF790094,A/Wyoming/18/2012(H3N2))6 neuraminidase (NA) gene                
                   124 >KF789559,A/Idaho/03/2013(H3N2))6 neuraminidase (NA) gene                  ...........................................................................C....A..G....C.....A..........................A....R.......T....G..............................G.......T..................A....................AT..............C.TT.G....................................................A..A..C.....................G.....G....................T.................C......       25     25 ,     25     25     124:>KF789559,A/Idaho/03/2013(H3N2))6 neuraminidase (NA) gene                  
                   125 >KF790519,A/Arizona/11/2012(H3N2))6 neuraminidase (NA) gene                ...........................................................................C....A..G....C.....A..........................A....R.......T....G..............................G.......T..................A....................AT..............C.TT.G....................................................A..A..C.....................G.....G....................T.................C......       25     25 ,     25     25     125:>KF790519,A/Arizona/11/2012(H3N2))6 neuraminidase (NA) gene                
                   126 >KF789643,A/New Mexico/11/2013(H3N2))6 neuraminidase (NA) gene             ...........................................................................C....A..G....C.....A..........................A...R........T....G..............................G......CT..................A....................AT..............C.TT.G....................................................A..A..C.....................G.....G....................T.................C......       26     26 ,     26     26     126:>KF789643,A/New Mexico/11/2013(H3N2))6 neuraminidase (NA) gene             
                   127 >KF790405,A/New York/60/2012(H3N2))6 neuraminidase (NA) gene               .......................................A...................................C....A..G....C.....A..........................A...R........T....G..............................G..G....T..................A....................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       24     24 ,     24     24     127:>KF790405,A/New York/60/2012(H3N2))6 neuraminidase (NA) gene               
                   128 >KF789586,A/New Jersey/04/2012(H3N2))6 neuraminidase (NA) gene             ...........................................................................C....A..G....C.....A..........................A.M.R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C.................G...G.....G....................T.................C......       24     24 ,     24     24     128:>KF789586,A/New Jersey/04/2012(H3N2))6 neuraminidase (NA) gene             
                   129 >KF789565,A/Michigan/01/2013(H3N2))6 neuraminidase (NA) gene               .............A........................................A....................C....A..G....C.....A..........................A...R........T....G........................T.....G.......T..................A..G.................AT..............C.........................................................AC.A..C.....................G.....G....................T.................C......       27     27 ,     27     27     129:>KF789565,A/Michigan/01/2013(H3N2))6 neuraminidase (NA) gene               
                   130 >KF789844,A/Washington/07/2013(H3N2))6 neuraminidase (NA) gene             .....G................................................A....................C....A..G....C.....A..........................A...R........T....G........................T.....G.......T.A................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       27     27 ,     27     27     130:>KF789844,A/Washington/07/2013(H3N2))6 neuraminidase (NA) gene             
                   131 >KF790387,A/Delaware/06/2013(H3N2))6 neuraminidase (NA) gene               ......................................................A....................C....A..G....C.....A..........................A...R........T....G........................T.....G.......T..................A..G.................AT..............C...T.....................................................A..A..C.....................G.....G....................T.................C......       26     26 ,     26     26     131:>KF790387,A/Delaware/06/2013(H3N2))6 neuraminidase (NA) gene               
                   132 >KF790073,A/Oregon/15/2012(H3N2))6 neuraminidase (NA) gene                 ......................................................A....................C....A..G....C.....A..........................A...R........T....G........................T.....G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       25     25 ,     25     25     132:>KF790073,A/Oregon/15/2012(H3N2))6 neuraminidase (NA) gene                 
                   133 >KF790005,A/Washington/50/2012(H3N2))6 neuraminidase (NA) gene             ......................................................A....................C....A..G....C.....A..........................A...R........T....G........................T.....G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       25     25 ,     25     25     133:>KF790005,A/Washington/50/2012(H3N2))6 neuraminidase (NA) gene             
                   134 >KF790158,A/Delaware/24/2012(H3N2))6 neuraminidase (NA) gene               ......................................................A....................C....A..G....C.....A..........................A...R........T....G........................T.....G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       25     25 ,     25     25     134:>KF790158,A/Delaware/24/2012(H3N2))6 neuraminidase (NA) gene               
                   135 >KF789549,A/Washington/06/2013(H3N2))6 neuraminidase (NA) gene             ......................................................A....................C....A..G....C.....A..........................A...R........T....G........................T.....G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       25     25 ,     25     25     135:>KF789549,A/Washington/06/2013(H3N2))6 neuraminidase (NA) gene             
                   136 >KF790327,A/Washington/04/2013(H3N2))6 neuraminidase (NA) gene             ......................................................A....................C....A..G....C.....A..........................A...R........T....G........................T.....G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       25     25 ,     25     25     136:>KF790327,A/Washington/04/2013(H3N2))6 neuraminidase (NA) gene             
                   137 >KF789814,A/Idaho/37/2012(H3N2))6 neuraminidase (NA) gene                  ......................................................A....................C....A..G....C.....A..........................A...R........T....G........................T.....G.......T.....................G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       24     24 ,     24     24     137:>KF789814,A/Idaho/37/2012(H3N2))6 neuraminidase (NA) gene                  
                   138 >KF790406,A/New Hampshire/03/2013(H3N2))6 neuraminidase (NA) gene          ......................................................A....................C....A..G....C.....A..........................A...R........T....G........................T.....G.......T..................A..G.................AT..............C......C.CC...T..................CCC..C.......C..........GA..A..C..........T..........G.....G....................T.................C......       36     36 ,     36     36     138:>KF790406,A/New Hampshire/03/2013(H3N2))6 neuraminidase (NA) gene          
                   139 >KF789620,A/California/16/2013(H3N2))6 neuraminidase (NA) gene             ......................................................A....................C....A..G....C.....A.A........................A...R........T....G..........G.............T.....G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       27     27 ,     27     27     139:>KF789620,A/California/16/2013(H3N2))6 neuraminidase (NA) gene             
                   140 >KF790337,A/Missouri/02/2013(H3N2))6 neuraminidase (NA) gene               ......................................................A....................C....A..G....C.....A..........................A...R........T....G..........G.............T.A...G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       27     27 ,     27     27     140:>KF790337,A/Missouri/02/2013(H3N2))6 neuraminidase (NA) gene               
                   141 >KF790067,A/Nebraska/02/2013(H3N2))6 neuraminidase (NA) gene               ......................................................A....................C....A..G....C.....A..........................A....R.......T....G..........G.............T.A...G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       27     27 ,     27     27     141:>KF790067,A/Nebraska/02/2013(H3N2))6 neuraminidase (NA) gene               
                   142 >KF790069,A/Minnesota/01/2013(H3N2))6 neuraminidase (NA) gene              ......................................................A....................C....A..G....C.....A..........................A............T....G..........G.............T.A...G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       26     26 ,     26     26     142:>KF790069,A/Minnesota/01/2013(H3N2))6 neuraminidase (NA) gene              
                   143 >KF790499,A/Minnesota/17/2012(H3N2))6 neuraminidase (NA) gene              ......................................................A....................C....A..G....C.....A..........................A............T....G..........G.............T.A...G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C...Y..       27     27 ,     27     27     143:>KF790499,A/Minnesota/17/2012(H3N2))6 neuraminidase (NA) gene              
                   144 >KF790151,A/Colorado/27/2012(H3N2))6 neuraminidase (NA) gene               ......................................................A....................C....A..G....C.....A..........................A............T....G..........G.............T.A...G.......T...........G......A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       27     27 ,     27     27     144:>KF790151,A/Colorado/27/2012(H3N2))6 neuraminidase (NA) gene               
                   145 >KF790358,A/Utah/03/2013(H3N2))6 neuraminidase (NA) gene                   ......................................................A....................C....A..G....C.....A.......................A..A............T....G..........G.............T.....G.......T..................A..G.................AT..............C....C....................................................A..A..C.....................G.....G......CC..........A.T.................C......       30     30 ,     30     30     145:>KF790358,A/Utah/03/2013(H3N2))6 neuraminidase (NA) gene                   
                   146 >KF789777,A/Washington/60/2012(H3N2))6 neuraminidase (NA) gene             ......................................................A....................C....A..G....C.....A..........................A............T....G........................T.....G.......T..T...............A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       25     25 ,     25     25     146:>KF789777,A/Washington/60/2012(H3N2))6 neuraminidase (NA) gene             
                   147 >KF790308,A/Maryland/01/2013(H3N2))6 neuraminidase (NA) gene               ......................................................A....................C....A..G....C.....A..........................A....W.......T....G........................T.....G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       25     25 ,     25     25     147:>KF790308,A/Maryland/01/2013(H3N2))6 neuraminidase (NA) gene               
                   148 >KF789593,A/Nevada/27/2012(H3N2))6 neuraminidase (NA) gene                 ......................................................A....................C....A..G....C.....A..........................A....R.......T....G........................T.....G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       25     25 ,     25     25     148:>KF789593,A/Nevada/27/2012(H3N2))6 neuraminidase (NA) gene                 
                   149 >KF789795,A/Washington/61/2012(H3N2))6 neuraminidase (NA) gene             ......................................................A....................C....A..G....C.....A..........................A....R.......T....G........................T.....G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       25     25 ,     25     25     149:>KF789795,A/Washington/61/2012(H3N2))6 neuraminidase (NA) gene             
                   150 >KF790518,A/Nevada/03/2013(H3N2))6 neuraminidase (NA) gene                 ...................................................A..A....................C....A..G....C.....A..........................A....R.......T....G........................T.....G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       26     26 ,     26     26     150:>KF790518,A/Nevada/03/2013(H3N2))6 neuraminidase (NA) gene                 
                   151 >KF790312,A/Nevada/36/2012(H3N2))6 neuraminidase (NA) gene                 ...................................................A..A....................C....A..G....C.....A..........................A....R.......T....G........................T.....G.......T..................A..G.................AT..............C.........................................................A..A..C.....................G.....G....................T.................C......       26     26 ,     26     26     151:>KF790312,A/Nevada/36/2012(H3N2))6 neuraminidase (NA) gene                 
                   152 >KF789827,A/Idaho/38/2012(H3N2))6 neuraminidase (NA) gene                  ......................................................A....................C....A..G....C..C..A.....A....................A....R.......T....G........................T.....G.......T..................A..G.................AT..............CA........................................................A..A..C.....................G.....G....................T.................C......       28     28 ,     28     28     152:>KF789827,A/Idaho/38/2012(H3N2))6 neuraminidase (NA) gene                  
                   153 >KF789956,A/Montana/01/2013(H3N2))6 neuraminidase (NA) gene                ......................................................A....................C....A..G....C..C..A..........................A............T....G........................T.....G.......T..................A..G.................AT..............CA........................................................A..A..C.....................G.....G....................T.................C......       26     26 ,     26     26     153:>KF789956,A/Montana/01/2013(H3N2))6 neuraminidase (NA) gene                
                   154 >KF789540,A/Colorado/02/2013(H3N2))6 neuraminidase (NA) gene               ......................................................A....................C....A..G....C..C..A..........................A............T....G........................T.....G.......T..................A..G.................AT..............CA........................................................A..A..C.....................G.....G....................T.................C......       26     26 ,     26     26     154:>KF789540,A/Colorado/02/2013(H3N2))6 neuraminidase (NA) gene               
                   155 >KF790496,A/Washington/53/2012(H3N2))6 neuraminidase (NA) gene             ......................................................A....................C....A..G....C..C..A..........................A...R........T....G........................T.....G.......T..................A..G.................AT..............CA........................................................A..A..C.....................G.....G....................T.................C......       27     27 ,     27     27     155:>KF790496,A/Washington/53/2012(H3N2))6 neuraminidase (NA) gene             
                   156 >KF790449,A/Utah/27/2012(H3N2))6 neuraminidase (NA) gene                   ......................................................A....................C....A..G....C.....A.........C................A...R........T....G........................T.....G.......T..................A..G.................AT..............CA........................................................A..A..C.....................G.....G....................T.................C......       27     27 ,     27     27     156:>KF790449,A/Utah/27/2012(H3N2))6 neuraminidase (NA) gene                   
                   157 >KF790493,A/Idaho/24/2012(H3N2))6 neuraminidase (NA) gene                  ......................................................A....................C....A..G....C.....A..........................A.Y.R........T....G........................T.....G.......T..................A..G.................AT.......T......CA........................................................A..A..C.....................G.....G....................T.................C......       28     28 ,     28     28     157:>KF790493,A/Idaho/24/2012(H3N2))6 neuraminidase (NA) gene                  
                   158 >KF790108,A/Idaho/23/2012(H3N2))6 neuraminidase (NA) gene                  ......................................................A....................C....A..G....C.....A..........................A.Y..........T....G........................T.....G.......T..................A..G.................AT..............CA........................................................A..A..C.....................G.....G....................T.................C......       26     26 ,     26     26     158:>KF790108,A/Idaho/23/2012(H3N2))6 neuraminidase (NA) gene                  
                   159 >KF789746,A/Alaska/01/2013(H3N2))6 neuraminidase (NA) gene                 ...............A......................................A....................C....A..G....C.....A..........................A.Y..........T....G........................T.....G.......T..................A..G.................AT..............C.........................................................A..A..CA....................G.....G....................T.................C......       27     27 ,     27     27     159:>KF789746,A/Alaska/01/2013(H3N2))6 neuraminidase (NA) gene                 
                   160 >KF790346,A/Utah/07/2013(H3N2))6 neuraminidase (NA) gene                   ...........................................................................C....A..G....C................................A.A..........T....G.........A....................G.......T..................A..G.................AT..............C.........................................................A..A..C...........................G....................T.................C......       22     22 ,     22     22     160:>KF790346,A/Utah/07/2013(H3N2))6 neuraminidase (NA) gene                   
                   161 >KF789920,A/Maryland/30/2012(H3N2))6 neuraminidase (NA) gene               ............................................G.............A................C....A..G....C......T.......T.................A.T..........T....G..............................G.......T..................A....................AT..............C.....................................C...................A..A..C.......T...................G....................T.................C......       26     26 ,     26     26     161:>KF789920,A/Maryland/30/2012(H3N2))6 neuraminidase (NA) gene               
                   162 >KF790437,A/Oregon/11/2012(H3N2))6 neuraminidase (NA) gene                 ............................................G..............................C....A..G....C..............T.................A....R.......T....GC.............................G.......T..................A....................AT..............C................................................A........A..A..C.......T.................A.G....................T.................C......       26     26 ,     26     26     162:>KF790437,A/Oregon/11/2012(H3N2))6 neuraminidase (NA) gene                 
                   163 >KF790266,A/Oklahoma/05/2012(H3N2))6 neuraminidase (NA) gene               ............................................G..............................C....A..G....C................................A............T....GC.............................G.......T..................A....................AT..............C..................................................T......A..A..C.......T....Y............A.G....................T..A..........Y...C......       27     27 ,     27     27     163:>KF790266,A/Oklahoma/05/2012(H3N2))6 neuraminidase (NA) gene               
                   164 >KF789876,A/New Hampshire/21/2012(H3N2))6 neuraminidase (NA) gene          ...........................................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       19     19 ,     19     19     164:>KF789876,A/New Hampshire/21/2012(H3N2))6 neuraminidase (NA) gene          
                   165 >KF789584,A/Florida/46/2012(H3N2))6 neuraminidase (NA) gene                ...........................................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       19     19 ,     19     19     165:>KF789584,A/Florida/46/2012(H3N2))6 neuraminidase (NA) gene                
                   166 >KF790471,A/North Dakota/01/2013(H3N2))6 neuraminidase (NA) gene           ...........................................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       19     19 ,     19     19     166:>KF790471,A/North Dakota/01/2013(H3N2))6 neuraminidase (NA) gene           
                   167 >KF789835,A/Wisconsin/06/2013(H3N2))6 neuraminidase (NA) gene              ...........................................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       19     19 ,     19     19     167:>KF789835,A/Wisconsin/06/2013(H3N2))6 neuraminidase (NA) gene              
                   168 >KF789821,A/Connecticut/13/2012(H3N2))6 neuraminidase (NA) gene            ...........................................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       19     19 ,     19     19     168:>KF789821,A/Connecticut/13/2012(H3N2))6 neuraminidase (NA) gene            
                   169 >KF790289,A/Iowa/15/2012(H3N2))6 neuraminidase (NA) gene                   ...........................................................................C....A..G....C................................A............T....G..............................G...A...T..................A....................AT..............C.................A.......................................A..A..C...........................G....................T.................C......       21     21 ,     21     21     169:>KF790289,A/Iowa/15/2012(H3N2))6 neuraminidase (NA) gene                   
                   170 >KF789797,A/Iowa/22/2012(H3N2))6 neuraminidase (NA) gene                   ...........................................................................C....A..G....C................................A...R........T....G..............................G...A...T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       21     21 ,     21     21     170:>KF789797,A/Iowa/22/2012(H3N2))6 neuraminidase (NA) gene                   
                   171 >KF790383,A/New Mexico/24/2012(H3N2))6 neuraminidase (NA) gene             ...........................................................................C....A..G.G..C................................A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       21     21 ,     21     21     171:>KF790383,A/New Mexico/24/2012(H3N2))6 neuraminidase (NA) gene             
                   172 >KF790306,A/Nebraska/15/2012(H3N2))6 neuraminidase (NA) gene               ...........C...............................................................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       21     21 ,     21     21     172:>KF790306,A/Nebraska/15/2012(H3N2))6 neuraminidase (NA) gene               
                   173 >KF790421,A/Nebraska/03/2013(H3N2))6 neuraminidase (NA) gene               .......A...C...............................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G.........A..........T.................C......       22     22 ,     22     22     173:>KF790421,A/Nebraska/03/2013(H3N2))6 neuraminidase (NA) gene               
                   174 >KF790476,A/Iowa/01/2013(H3N2))6 neuraminidase (NA) gene                   ...........................................................................C....A..G....C................................A.A....A.....T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G.........A..........T.................C......       22     22 ,     22     22     174:>KF790476,A/Iowa/01/2013(H3N2))6 neuraminidase (NA) gene                   
                   175 >KF789878,A/Virginia/03/2013(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C.................C..............A.A..........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       21     21 ,     21     21     175:>KF789878,A/Virginia/03/2013(H3N2))6 neuraminidase (NA) gene               
                   176 >KF790128,A/North Carolina/06/2013(H3N2))6 neuraminidase (NA) gene         ...........................................................................C....A..G....C.................C..............A.Y..........T....G..............................G.......T..................A....................AT..............C..............C..........................................A..AT.C...........................G....................T.................C......       23     23 ,     23     23     176:>KF790128,A/North Carolina/06/2013(H3N2))6 neuraminidase (NA) gene         
                   177 >KF790382,A/Minnesota/04/2013(H3N2))6 neuraminidase (NA) gene              ...........................................................................C....A..G....C.................C..............A............T....G..............................G.......T..................A........G...........AT..............C..............C..........................................A..A..C...........................G....................T.................C......       22     22 ,     22     22     177:>KF790382,A/Minnesota/04/2013(H3N2))6 neuraminidase (NA) gene              
                   178 >KF789962,A/Rhode Island/02/2013(H3N2))6 neuraminidase (NA) gene           .......................................................................T...C....A..G....C...........A.....C..............A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       22     22 ,     22     22     178:>KF789962,A/Rhode Island/02/2013(H3N2))6 neuraminidase (NA) gene           
                   179 >KF790012,A/Massachusetts/07/2013(H3N2))6 neuraminidase (NA) gene          ...........................................................................C....A..G....C............T....C......M.......A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       22     22 ,     22     22     179:>KF790012,A/Massachusetts/07/2013(H3N2))6 neuraminidase (NA) gene          
                   180 >KF790146,A/Arkansas/13/2013(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C............T....CT.............A............T....G..............................G.......T..................A....................AT..............C.........................................................A.AA..C...........................G....................T.....C...........C......       24     24 ,     24     24     180:>KF790146,A/Arkansas/13/2013(H3N2))6 neuraminidase (NA) gene               
                   181 >KF789733,A/New York/04/2013(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C................TCT.............A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.....C...........C......       24     24 ,     24     24     181:>KF789733,A/New York/04/2013(H3N2))6 neuraminidase (NA) gene               
                   182 >KF790484,A/Arkansas/06/2013(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C.................CT.............A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A.AA..C...........................G....................T.....C...........C......       24     24 ,     24     24     182:>KF790484,A/Arkansas/06/2013(H3N2))6 neuraminidase (NA) gene               
                   183 >KF789979,A/Arkansas/04/2013(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C.................CT.............A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A.AA..C...........................G....................T.....C...........C......       24     24 ,     24     24     183:>KF789979,A/Arkansas/04/2013(H3N2))6 neuraminidase (NA) gene               
                   184 >KF789980,A/Arkansas/03/2013(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C.................CT.............A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A.AA..C...........................G....................T.....C...........C......       24     24 ,     24     24     184:>KF789980,A/Arkansas/03/2013(H3N2))6 neuraminidase (NA) gene               
                   185 >KF790033,A/Arkansas/07/2013(H3N2))6 neuraminidase (NA) gene               .........G.................................................................C....A..G....C.................CT.............A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A.AA..C...........................G....................T.....C...........C......       25     25 ,     25     25     185:>KF790033,A/Arkansas/07/2013(H3N2))6 neuraminidase (NA) gene               
                   186 >KF790511,A/Maryland/33/2012(H3N2))6 neuraminidase (NA) gene               ...G.................................................................T.....C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C......................C..................................A.AA..C...........................G....................T.................C......       24     24 ,     24     24     186:>KF790511,A/Maryland/33/2012(H3N2))6 neuraminidase (NA) gene               
                   187 >KF790121,A/North Carolina/02/2013(H3N2))6 neuraminidase (NA) gene         ...........................................................................C....A..G....C................................A...R........T....G...........................A..G.......T..................A....................AT..............C......................C..................................A..A..C...........................G....................T.................C......       22     22 ,     22     22     187:>KF790121,A/North Carolina/02/2013(H3N2))6 neuraminidase (NA) gene         
                   188 >KF789622,A/Oklahoma/06/2013(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C................................A...R........T....G...........................A..G.......T..................A....................AT..............C......................C..................................A..A..C...........................G....................T.................C......       22     22 ,     22     22     188:>KF789622,A/Oklahoma/06/2013(H3N2))6 neuraminidase (NA) gene               
                   189 >KF790013,A/New Mexico/08/2013(H3N2))6 neuraminidase (NA) gene             ...........................................................................C....A..G....C................................A....R.......T....G...........................A..G.......T.................TA....................AT..............C......................C...............................A..A..A..C...........................G....................T.................C......       24     24 ,     24     24     189:>KF790013,A/New Mexico/08/2013(H3N2))6 neuraminidase (NA) gene             
                   190 >KF789676,A/Missouri/13/2012(H3N2))6 neuraminidase (NA) gene               ...G.................................................T.....................C....A..G....C................................A....R.......T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       23     23 ,     23     23     190:>KF789676,A/Missouri/13/2012(H3N2))6 neuraminidase (NA) gene               
                   191 >KF789702,A/Tennessee/02/2013(H3N2))6 neuraminidase (NA) gene              .....................................................T.....................C....A..G....C...............C................A....RC......T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G.A..................T.................C......       25     25 ,     25     25     191:>KF789702,A/Tennessee/02/2013(H3N2))6 neuraminidase (NA) gene              
                   192 >KF790020,A/Michigan/03/2013(H3N2))6 neuraminidase (NA) gene               .....................................................T.....................C....A..G....C...............C................A............T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C.......A...................G....................T.................C......       23     23 ,     23     23     192:>KF790020,A/Michigan/03/2013(H3N2))6 neuraminidase (NA) gene               
                   193 >KF790530,A/Kansas/01/2013(H3N2))6 neuraminidase (NA) gene                 .....................................................T.....................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       21     21 ,     21     21     193:>KF790530,A/Kansas/01/2013(H3N2))6 neuraminidase (NA) gene                 
                   194 >KF790359,A/Mississippi/01/2013(H3N2))6 neuraminidase (NA) gene            .....................................................T.....................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       21     21 ,     21     21     194:>KF790359,A/Mississippi/01/2013(H3N2))6 neuraminidase (NA) gene            
                   195 >KF790390,A/Wisconsin/05/2013(H3N2))6 neuraminidase (NA) gene              .....................................................T.....................C....A..G....C................................A...........GT....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       22     22 ,     22     22     195:>KF790390,A/Wisconsin/05/2013(H3N2))6 neuraminidase (NA) gene              
                   196 >KF789789,A/Nevada/28/2012(H3N2))6 neuraminidase (NA) gene                 .....................................................T...T.................C....A..G....C................................A............T....G..............................G.......T..................A...................TAT..............C......................................................A..A..A..C...........................G....................T.................C......       23     23 ,     23     23     196:>KF789789,A/Nevada/28/2012(H3N2))6 neuraminidase (NA) gene                 
                   197 >KF789617,A/Vermont/02/2013(H3N2))6 neuraminidase (NA) gene                .....................................................T.....................C....A..G....C................................A............T....G..............................G.......T..................A...................TATT.............C......................................................A..A..A..C...........................G....................T.................C......       23     23 ,     23     23     197:>KF789617,A/Vermont/02/2013(H3N2))6 neuraminidase (NA) gene                
                   198 >KF790071,A/Colorado/01/2013(H3N2))6 neuraminidase (NA) gene               .....................................................T.....................C....A..G....C................................A............T....G..............................G.......T................G.A............G.......AT..............C......................................................A..A..A..C...........................G....................T.................C......       23     23 ,     23     23     198:>KF790071,A/Colorado/01/2013(H3N2))6 neuraminidase (NA) gene               
                   199 >KF789632,A/Kansas/02/2013(H3N2))6 neuraminidase (NA) gene                 .....................................................T.....................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C........................A..G.....T..............T.................C......       23     23 ,     23     23     199:>KF789632,A/Kansas/02/2013(H3N2))6 neuraminidase (NA) gene                 
                   200 >KF790162,A/Wisconsin/38/2012(H3N2))6 neuraminidase (NA) gene              .....................................................T.....................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G.....T..............T.................C......       22     22 ,     22     22     200:>KF790162,A/Wisconsin/38/2012(H3N2))6 neuraminidase (NA) gene              
                   201 >KF789817,A/Illinois/15/2012(H3N2))6 neuraminidase (NA) gene               .....................................................T.....................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G.....T..............T.................C......       22     22 ,     22     22     201:>KF789817,A/Illinois/15/2012(H3N2))6 neuraminidase (NA) gene               
                   202 >KF789963,A/Illinois/01/2013(H3N2))6 neuraminidase (NA) gene               .....................................................T.....................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G.....T..............T.................C......       23     23 ,     23     23     202:>KF789963,A/Illinois/01/2013(H3N2))6 neuraminidase (NA) gene               
                   203 >KF789734,A/Minnesota/03/2013(H3N2))6 neuraminidase (NA) gene              .....................................................T.....................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G.....T..............T.................C......       23     23 ,     23     23     203:>KF789734,A/Minnesota/03/2013(H3N2))6 neuraminidase (NA) gene              
                   204 >KF790456,A/Louisiana/01/2013(H3N2))6 neuraminidase (NA) gene              .....................................................T.....................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....RT..............T.................C......       24     24 ,     24     24     204:>KF790456,A/Louisiana/01/2013(H3N2))6 neuraminidase (NA) gene              
                   205 >KF790374,A/Ohio/92/2012(H3N2))6 neuraminidase (NA) gene                   .....................................................T.....................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       22     22 ,     22     22     205:>KF790374,A/Ohio/92/2012(H3N2))6 neuraminidase (NA) gene                   
                   206 >KF789566,A/California/14/2013(H3N2))6 neuraminidase (NA) gene             .....................................................T.....................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       22     22 ,     22     22     206:>KF789566,A/California/14/2013(H3N2))6 neuraminidase (NA) gene             
                   207 >KF790322,A/Pennsylvania/02/2013(H3N2))6 neuraminidase (NA) gene           .....................................................T.....................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       22     22 ,     22     22     207:>KF790322,A/Pennsylvania/02/2013(H3N2))6 neuraminidase (NA) gene           
                   208 >KF790442,A/Wisconsin/41/2012(H3N2))6 neuraminidase (NA) gene              .....................................................T.....................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       22     22 ,     22     22     208:>KF790442,A/Wisconsin/41/2012(H3N2))6 neuraminidase (NA) gene              
                   209 >KF789638,A/Connecticut/01/2013(H3N2))6 neuraminidase (NA) gene            .....................................................T.....................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       22     22 ,     22     22     209:>KF789638,A/Connecticut/01/2013(H3N2))6 neuraminidase (NA) gene            
                   210 >KF790460,A/California/10/2013(H3N2))6 neuraminidase (NA) gene             .....................................................T.....................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       22     22 ,     22     22     210:>KF790460,A/California/10/2013(H3N2))6 neuraminidase (NA) gene             
                   211 >KF789625,A/Louisiana/02/2013(H3N2))6 neuraminidase (NA) gene              .....................................................T.....................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C...............................A......................A..A..A..C...........................G....................T.................C......       23     23 ,     23     23     211:>KF789625,A/Louisiana/02/2013(H3N2))6 neuraminidase (NA) gene              
                   212 >KF789705,A/Colorado/21/2012(H3N2))6 neuraminidase (NA) gene               .....................................................T.....................C....A..G....C................................A.A..........T....G..............................G.......T..................A....................AT..............C............................C.........................A..A..A..C...........................G....................T.................C......       23     23 ,     23     23     212:>KF789705,A/Colorado/21/2012(H3N2))6 neuraminidase (NA) gene               
                   213 >KF790335,A/District Of Columbia/01/2012(H3N2))6 neuraminidase (NA) gene   .....................................................T.....................C....A..G....C................................A.M..........T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       22     22 ,     22     22     213:>KF790335,A/District Of Columbia/01/2012(H3N2))6 neuraminidase (NA) gene   
                   214 >KF790458,A/New Mexico/04/2013(H3N2))6 neuraminidase (NA) gene             .....................................................T............G........C....A..G....C...A............................A.Y..........T....G.....A........................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       25     25 ,     25     25     214:>KF790458,A/New Mexico/04/2013(H3N2))6 neuraminidase (NA) gene             
                   215 >KF789657,A/Oregon/01/2013(H3N2))6 neuraminidase (NA) gene                 .....................................................T............G........C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C................................................T.................C......       21     21 ,     21     21     215:>KF789657,A/Oregon/01/2013(H3N2))6 neuraminidase (NA) gene                 
                   216 >KF789655,A/Oregon/01/2013(H3N2))6 neuraminidase (NA) gene                 .....................................................T............G........C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C................................................T.................C......       21     21 ,     21     21     216:>KF789655,A/Oregon/01/2013(H3N2))6 neuraminidase (NA) gene                 
                   217 >KF790284,A/North Dakota/05/2012(H3N2))6 neuraminidase (NA) gene           .....................................................T................T....C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       22     22 ,     22     22     217:>KF790284,A/North Dakota/05/2012(H3N2))6 neuraminidase (NA) gene           
                   218 >KF790350,A/Mississippi/02/2013(H3N2))6 neuraminidase (NA) gene            .....................................................T.....................C....A..G....C................................A..C.........T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       22     22 ,     22     22     218:>KF790350,A/Mississippi/02/2013(H3N2))6 neuraminidase (NA) gene            
                   219 >KF789758,A/Michigan/32/2012(H3N2))6 neuraminidase (NA) gene               .....................................................T.....................C....A..G....C................................A..C.........T....G..............................G.......T..................A....................AT..............C......................................................A..A..A..C...........................G....................T.................C......       22     22 ,     22     22     219:>KF789758,A/Michigan/32/2012(H3N2))6 neuraminidase (NA) gene               
                   220 >KF789881,A/Maine/11/2012(H3N2))6 neuraminidase (NA) gene                  .....................................................T.....................C....A..G....C................................A..CA........T....G.........A....................G.......T..................A....................AT..............C....................G.................................A..A..A..CA..........................G....................T...G.............C......       27     27 ,     27     27     220:>KF789881,A/Maine/11/2012(H3N2))6 neuraminidase (NA) gene                  
                   221 >KF790504,A/California/12/2013(H3N2))6 neuraminidase (NA) gene             .....................................................T......G..............C....A..G....C.....................A..........A..CR........T....G..............................G.......T..................A....................AT..............C...................................A..................A..A..A..CA..........................G....................T.................C......       27     27 ,     27     27     221:>KF790504,A/California/12/2013(H3N2))6 neuraminidase (NA) gene             
                   222 >KF790045,A/Georgia/03/2013(H3N2))6 neuraminidase (NA) gene                ......................................T..............T.....................C....A..G....C................................A...R........T....G.C........................A...G....T..T..................A....................AT..........T...C..........................T..............................A..A..CA..........................G....................T.................C......       28     28 ,     28     28     222:>KF790045,A/Georgia/03/2013(H3N2))6 neuraminidase (NA) gene                
                   223 >KF790139,A/Georgia/03/2013(H3N2))6 neuraminidase (NA) gene                ......................................T..............T.....................C....A..G....C................................A............T....G.C........................A...G....T..T..................A....................AT..........T...C..........................T..............................A..A..CA..........................G....................T.................C......       27     27 ,     27     27     223:>KF790139,A/Georgia/03/2013(H3N2))6 neuraminidase (NA) gene                
                   224 >KF789857,A/Kansas/04/2013(H3N2))6 neuraminidase (NA) gene                 .....................................................T.....................C....A..G....C................................A....R.......T....G.C..............A.............G....T..T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       24     24 ,     24     24     224:>KF789857,A/Kansas/04/2013(H3N2))6 neuraminidase (NA) gene                 
                   225 >KF790521,A/Kansas/11/2012(H3N2))6 neuraminidase (NA) gene                 .....................................................T.....................C....A..G.G..C................................A....R.......T....G.C.................................T..T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     225:>KF790521,A/Kansas/11/2012(H3N2))6 neuraminidase (NA) gene                 
                   226 >KF790031,A/Nevada/05/2013(H3N2))6 neuraminidase (NA) gene                 .....................................................T.....................C....A..GT...C................................A...A........T....G.C............................G....T..T..................AG...................AT..............C.........................................................A..A..C...........................G....................T.................C......       25     25 ,     25     25     226:>KF790031,A/Nevada/05/2013(H3N2))6 neuraminidase (NA) gene                 
                   227 >KF790016,A/New Mexico/09/2013(H3N2))6 neuraminidase (NA) gene             .....................................................T.....................C....A..G....C................................A...R........T....G.C............................G....T..T..................AG...................AT..............C.........................................................A..A..C...........................G....................T.................C......       24     24 ,     24     24     227:>KF790016,A/New Mexico/09/2013(H3N2))6 neuraminidase (NA) gene             
                   228 >KF790468,A/California/22/2013(H3N2))6 neuraminidase (NA) gene             ...................T.................................TA....................C....A..G....C................................A...R........T....G.C.T..........................G....T..T..................A...............C....AT..............C....................................G....................A..A..C..................C........G....................T.................C......       29     29 ,     29     29     228:>KF790468,A/California/22/2013(H3N2))6 neuraminidase (NA) gene             
                   229 >KF790192,A/Alaska/04/2013(H3N2))6 neuraminidase (NA) gene                 ...................T.................................TA....................C....A..G....C................................A...R........T....G.C................A...........G....T..T..................A..G.................AT..............C.........................................................A..A..C..................C........G....................T.................C......       28     28 ,     28     28     229:>KF790192,A/Alaska/04/2013(H3N2))6 neuraminidase (NA) gene                 
                   230 >KF789855,A/Minnesota/05/2013(H3N2))6 neuraminidase (NA) gene              ......................G..............................T.....................C....A..G....C................................A...R........T....G.C................A..........GG.G..T..T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       27     27 ,     27     27     230:>KF789855,A/Minnesota/05/2013(H3N2))6 neuraminidase (NA) gene              
                   231 >KF790150,A/Alabama/07/2013(H3N2))6 neuraminidase (NA) gene                ......................G..............................T.....................C....A..G....C................................A....R.......T....G..............................G.......T..................A.........T..........AT..............C....................................................G....A..A.AC...........................G....................T.................C......       25     25 ,     25     25     231:>KF790150,A/Alabama/07/2013(H3N2))6 neuraminidase (NA) gene                
                   232 >KF789561,A/Nevada/04/2013(H3N2))6 neuraminidase (NA) gene                 ......................G..............................T.....................C....A..G....C................................A...R........T....G.................A............G.......T..................A.........T..........AT..............C....................................................G....A..A.AC...........................G....................T.................C......       26     26 ,     26     26     232:>KF789561,A/Nevada/04/2013(H3N2))6 neuraminidase (NA) gene                 
                   233 >KF789592,A/Indiana/164/2012(H3N2))6 neuraminidase (NA) gene               .....................................................T.....................C....A..G....C................................A...R........T....G..............................GC......T..................A.........T..........AT..............C....................................................G....A..A..C................C..........G....................T.................C......       25     25 ,     25     25     233:>KF789592,A/Indiana/164/2012(H3N2))6 neuraminidase (NA) gene               
                   234 >KF790259,A/Indiana/162/2012(H3N2))6 neuraminidase (NA) gene               .....................................................T.....................C....A..G....C................................A...R........T....G..............................GC......T..................A.........T..........AT.........A....C....................................................G....A..A..C................C..........G....................T.................C......       26     26 ,     26     26     234:>KF790259,A/Indiana/162/2012(H3N2))6 neuraminidase (NA) gene               
                   235 >KF790103,A/Colorado/18/2012(H3N2))6 neuraminidase (NA) gene               .....................................................T.....................C.G..A..G....C................................A...R........T....G..............................G.......T..................A.........T..........AT..............C...............................................G....G....A..A..C.......................A...G....................T.................C......       26     26 ,     26     26     235:>KF790103,A/Colorado/18/2012(H3N2))6 neuraminidase (NA) gene               
                   236 >KF790199,A/Colorado/18/2012(H3N2))6 neuraminidase (NA) gene               .....................................................T.....................C.G..A..G....C................................A............T....G..............................G.......T..................A.........T..........AT..............C...............................................G....G....A..A..C.......................A...G....................T.................C......       25     25 ,     25     25     236:>KF790199,A/Colorado/18/2012(H3N2))6 neuraminidase (NA) gene               
                   237 >KF790523,A/California/11/2013(H3N2))6 neuraminidase (NA) gene             .....................................................T.....................C....A..G....C.............................A..A...A........T....G.......................C......G.......T..................A.........T..........AT..............C.........................................................A..A..C...........................G...................GT.................C......       25     25 ,     25     25     237:>KF790523,A/California/11/2013(H3N2))6 neuraminidase (NA) gene             
                   238 >KF789563,A/California/13/2013(H3N2))6 neuraminidase (NA) gene             .....................................................T..T..................C....A..G....C.............................A..A...R........T....G..............................G.......T..................A.........T..........AT..............C............C...............................A............A..A..C...........................G....................T.................C......       26     26 ,     26     26     238:>KF789563,A/California/13/2013(H3N2))6 neuraminidase (NA) gene             
                   239 >KF790529,A/Idaho/02/2013(H3N2))6 neuraminidase (NA) gene                  ......................................A..............T.....................C....A..G....C.............................A..A...R........T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       25     25 ,     25     25     239:>KF790529,A/Idaho/02/2013(H3N2))6 neuraminidase (NA) gene                  
                   240 >KF789601,A/West Virginia/20/2012(H3N2))6 neuraminidase (NA) gene          .....................................................T.....................C....A..G....C.............................A..A...R........T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       24     24 ,     24     24     240:>KF789601,A/West Virginia/20/2012(H3N2))6 neuraminidase (NA) gene          
                   241 >KF789913,A/California/46/2012(H3N2))6 neuraminidase (NA) gene             .....................................................T.....................C....A..G....C.............................A..A...R........T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       24     24 ,     24     24     241:>KF789913,A/California/46/2012(H3N2))6 neuraminidase (NA) gene             
                   242 >KF789724,A/Missouri/04/2013(H3N2))6 neuraminidase (NA) gene               .....................................................T.....................C....A..G....C.............................A..A...R........T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       24     24 ,     24     24     242:>KF789724,A/Missouri/04/2013(H3N2))6 neuraminidase (NA) gene               
                   243 >KF789764,A/South Dakota/12/2012(H3N2))6 neuraminidase (NA) gene           .....................................................T.....................C....A..G....C.............................A..A...R........T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       24     24 ,     24     24     243:>KF789764,A/South Dakota/12/2012(H3N2))6 neuraminidase (NA) gene           
                   244 >KF789589,A/North Carolina/24/2012(H3N2))6 neuraminidase (NA) gene         ....................................T................T.....................C....A..G....C.............................A..A...R........T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       25     25 ,     25     25     244:>KF789589,A/North Carolina/24/2012(H3N2))6 neuraminidase (NA) gene         
                   245 >KF790477,A/South Dakota/01/2013(H3N2))6 neuraminidase (NA) gene           ................................A....................T.....................C....A..G....C.............................A..A...R........T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C....A......................G....................T.................C......       26     26 ,     26     26     245:>KF790477,A/South Dakota/01/2013(H3N2))6 neuraminidase (NA) gene           
                   246 >KF789669,A/Nebraska/11/2012(H3N2))6 neuraminidase (NA) gene               ................................A....................T.....................C....A..G....C.............................A..A...R........T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C....A......................G....................T.................C......       26     26 ,     26     26     246:>KF789669,A/Nebraska/11/2012(H3N2))6 neuraminidase (NA) gene               
                   247 >KF789936,A/North Dakota/08/2012(H3N2))6 neuraminidase (NA) gene           ................................A....................T.....................C....A..G....C.............................A..A............T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C....A......................G....................T.................C......       25     25 ,     25     25     247:>KF789936,A/North Dakota/08/2012(H3N2))6 neuraminidase (NA) gene           
                   248 >KF790007,A/South Dakota/16/2012(H3N2))6 neuraminidase (NA) gene           .....................................................T.....................C....A..G....C.............................A..A............T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C....A......................G....................T.................C......       24     24 ,     24     24     248:>KF790007,A/South Dakota/16/2012(H3N2))6 neuraminidase (NA) gene           
                   249 >KF790313,A/New Mexico/23/2012(H3N2))6 neuraminidase (NA) gene             ................C....................................T.....................C....A..G....C.............................A..A.....A......T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C....A......................G....................T.................C......       26     26 ,     26     26     249:>KF790313,A/New Mexico/23/2012(H3N2))6 neuraminidase (NA) gene             
                   250 >KF790441,A/Wyoming/20/2012(H3N2))6 neuraminidase (NA) gene                .....................................................T.....................C....A..G....C.............................A..A............T....G..............................G.......T..................A.........T..........AT..............C............C...A........................................A..A..C...........................G....................C.................C......       24     24 ,     24     24     250:>KF790441,A/Wyoming/20/2012(H3N2))6 neuraminidase (NA) gene                
                   251 >KF789679,A/North Carolina/05/2013(H3N2))6 neuraminidase (NA) gene         .....................................................T.....................C....A..G....C....................G......W.A..A............T....G..............................G.......T..................A.........T..........AT........R.....C............C............................................A..A..C...........................G....................T.................C......       26     26 ,     26     26     251:>KF789679,A/North Carolina/05/2013(H3N2))6 neuraminidase (NA) gene         
                   252 >KF790133,A/New York/03/2013(H3N2))6 neuraminidase (NA) gene               .....................................................T.....................C....A..G....C....................G........A..A............T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       24     24 ,     24     24     252:>KF790133,A/New York/03/2013(H3N2))6 neuraminidase (NA) gene               
                   253 >KF789765,A/Ohio/102/2012(H3N2))6 neuraminidase (NA) gene                  .....................................................T.....................C....A..G....C.............................A..A............T....G......A.......................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       24     24 ,     24     24     253:>KF789765,A/Ohio/102/2012(H3N2))6 neuraminidase (NA) gene                  
                   254 >KF789721,A/Vermont/19/2012(H3N2))6 neuraminidase (NA) gene                .....................................................T.....................C....A..G....C.............................A..A............T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     254:>KF789721,A/Vermont/19/2012(H3N2))6 neuraminidase (NA) gene                
                   255 >KF789718,A/Ohio/97/2012(H3N2))6 neuraminidase (NA) gene                   .....................................................T.....................C....A..G....C.............................A..A............T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     255:>KF789718,A/Ohio/97/2012(H3N2))6 neuraminidase (NA) gene                   
                   256 >KF789951,A/Ohio/01/2013(H3N2))6 neuraminidase (NA) gene                   .....................................................T.....................C....A..G....C.............................A..A............T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     256:>KF789951,A/Ohio/01/2013(H3N2))6 neuraminidase (NA) gene                   
                   257 >KF790367,A/Ohio/01/2013(H3N2))6 neuraminidase (NA) gene                   .....................................................T.....................C....A..G....C.............................A..A............T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     257:>KF790367,A/Ohio/01/2013(H3N2))6 neuraminidase (NA) gene                   
                   258 >KF790469,A/Nevada/02/2013(H3N2))6 neuraminidase (NA) gene                 .....................................................T.....................C....A..G....C.............................A..A............T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     258:>KF790469,A/Nevada/02/2013(H3N2))6 neuraminidase (NA) gene                 
                   259 >KF789811,A/South Dakota/12/2012(H3N2))6 neuraminidase (NA) gene           .....................................................T.....................C....A..G....C.............................A..A............T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     259:>KF789811,A/South Dakota/12/2012(H3N2))6 neuraminidase (NA) gene           
                   260 >KF789686,A/South Dakota/10/2012(H3N2))6 neuraminidase (NA) gene           .....................................................T.....................C....A..G....C.............................A..A............T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     260:>KF789686,A/South Dakota/10/2012(H3N2))6 neuraminidase (NA) gene           
                   261 >KF790131,A/Missouri/04/2013(H3N2))6 neuraminidase (NA) gene               .....................................................T.....................C....A..G....C.............................A..A............T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     261:>KF790131,A/Missouri/04/2013(H3N2))6 neuraminidase (NA) gene               
                   262 >KF790393,A/Idaho/01/2013(H3N2))6 neuraminidase (NA) gene                  .....................................................T.....................C....A..G....C.............................A..A....G.......T....G..............................G.......T..................A.........T..........AT...G..........C............C............................................A..A..C...........................G....................T.................C......       25     25 ,     25     25     262:>KF790393,A/Idaho/01/2013(H3N2))6 neuraminidase (NA) gene                  
                   263 >KF789792,A/South Dakota/14/2012(H3N2))6 neuraminidase (NA) gene           .....................................................T.....................C....A..G....C.............................A..A....R.......T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       24     24 ,     24     24     263:>KF789792,A/South Dakota/14/2012(H3N2))6 neuraminidase (NA) gene           
                   264 >KF790166,A/Michigan/25/2012(H3N2))6 neuraminidase (NA) gene               .....................A...............................T.....................C....A..G....C.............................A..A............T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       24     24 ,     24     24     264:>KF790166,A/Michigan/25/2012(H3N2))6 neuraminidase (NA) gene               
                   265 >KF790055,A/South Dakota/15/2012(H3N2))6 neuraminidase (NA) gene           .....................................................T.....................C....A..G....C.............................A..A............T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T........................       22     22 ,     22     22     265:>KF790055,A/South Dakota/15/2012(H3N2))6 neuraminidase (NA) gene           
                   266 >KF789820,A/Washington/62/2012(H3N2))6 neuraminidase (NA) gene             .....................................................T.....................C....A..G....C.............................A..A.A..........T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       24     24 ,     24     24     266:>KF789820,A/Washington/62/2012(H3N2))6 neuraminidase (NA) gene             
                   267 >KF790092,A/Iowa/13/2012(H3N2))6 neuraminidase (NA) gene                   .....................................................T.....................C....A..G....C.............................A..A.Y..........T....G..............................G.......T..................A.........T..........AT..............C............C............................................A..A..C...........................G....................T.................C......       24     24 ,     24     24     267:>KF790092,A/Iowa/13/2012(H3N2))6 neuraminidase (NA) gene                   
                   268 >KF789693,A/Massachusetts/11/2013(H3N2))6 neuraminidase (NA) gene          ....................C......................C...............................C....A..G....C................................A.Y..........T...................................G.......T..................A....................AT..............C.........................................................A..A..C...........................G...............A....T...........T.....C.A....       24     24 ,     24     24     268:>KF789693,A/Massachusetts/11/2013(H3N2))6 neuraminidase (NA) gene          
                   269 >KF790120,A/Oklahoma/03/2013(H3N2))6 neuraminidase (NA) gene               ..............C..............................................C.............C....A..G....C..........................G.....A.Y..........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     269:>KF790120,A/Oklahoma/03/2013(H3N2))6 neuraminidase (NA) gene               
                   270 >KF789976,A/North Carolina/01/2013(H3N2))6 neuraminidase (NA) gene         ..............C..............................................C.............C....A..G....C................................AT...........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       22     22 ,     22     22     270:>KF789976,A/North Carolina/01/2013(H3N2))6 neuraminidase (NA) gene         
                   271 >KF790132,A/Virginia/06/2013(H3N2))6 neuraminidase (NA) gene               ..............C..............................................C.............C....A..G....C................................A...R........T....G..............................G.......T...T..............A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     271:>KF790132,A/Virginia/06/2013(H3N2))6 neuraminidase (NA) gene               
                   272 >KF790123,A/Louisiana/04/2013(H3N2))6 neuraminidase (NA) gene              ..............C....................C.........................C.............C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     272:>KF790123,A/Louisiana/04/2013(H3N2))6 neuraminidase (NA) gene              
                   273 >KF790208,A/Alaska/04/2012(H3N2))6 neuraminidase (NA) gene                 ...................................C.......................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     273:>KF790208,A/Alaska/04/2012(H3N2))6 neuraminidase (NA) gene                 
                   274 >KC892417,A/Alaska/04/2012(H3N2))6 neuraminidase (NA) gene                 ...................................C.......................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     274:>KC892417,A/Alaska/04/2012(H3N2))6 neuraminidase (NA) gene                 
                   275 >KF790501,A/Texas/11/2013(H3N2))6 neuraminidase (NA) gene                  ..........................C........C.............................A.........C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       22     22 ,     22     22     275:>KF790501,A/Texas/11/2013(H3N2))6 neuraminidase (NA) gene                  
                   276 >KF789894,A/Wisconsin/51/2012(H3N2))6 neuraminidase (NA) gene              ..........................C................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     276:>KF789894,A/Wisconsin/51/2012(H3N2))6 neuraminidase (NA) gene              
                   277 >Index/32g12f1.c2,38-41                                                    ...........................................................................C....A..G....C................................A............T....G...................G..........G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     277:>Index/32g12f1.c2,38-41                                                    
                   278 >KF789744,A/Montana/03/2013(H3N2))6 neuraminidase (NA) gene                ...........................................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C.........G.................G....................T.................C......       20     20 ,     20     20     278:>KF789744,A/Montana/03/2013(H3N2))6 neuraminidase (NA) gene                
                   279 >KF789763,A/North Carolina/28/2012(H3N2))6 neuraminidase (NA) gene         ...........................................................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C.........G.................GC...................T......A.A........C......       23     23 ,     23     23     279:>KF789763,A/North Carolina/28/2012(H3N2))6 neuraminidase (NA) gene         
                   280 >KF790285,A/Iowa/14/2012(H3N2))6 neuraminidase (NA) gene                   ...........................................................................C....A..G....C................................A...A........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     280:>KF790285,A/Iowa/14/2012(H3N2))6 neuraminidase (NA) gene                   
                   281 >KF789837,A/New Jersey/03/2013(H3N2))6 neuraminidase (NA) gene             ...........................................................................C....A..G....C..................A.............A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     281:>KF789837,A/New Jersey/03/2013(H3N2))6 neuraminidase (NA) gene             
                   282 >KF789599,A/Alabama/24/2012(H3N2))6 neuraminidase (NA) gene                ................................A..........................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     282:>KF789599,A/Alabama/24/2012(H3N2))6 neuraminidase (NA) gene                
                   283 >KF789642,A/Kentucky/03/2013(H3N2))6 neuraminidase (NA) gene               ................................A..........................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     283:>KF789642,A/Kentucky/03/2013(H3N2))6 neuraminidase (NA) gene               
                   284 >KF789588,A/Montana/13/2012(H3N2))6 neuraminidase (NA) gene                ................................A..........................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     284:>KF789588,A/Montana/13/2012(H3N2))6 neuraminidase (NA) gene                
                   285 >KF790354,A/Kentucky/01/2013(H3N2))6 neuraminidase (NA) gene               ................................A..........................................C....A..G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     285:>KF790354,A/Kentucky/01/2013(H3N2))6 neuraminidase (NA) gene               
                   286 >KF789925,A/Alabama/17/2012(H3N2))6 neuraminidase (NA) gene                ................................A..........................................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       21     21 ,     21     21     286:>KF789925,A/Alabama/17/2012(H3N2))6 neuraminidase (NA) gene                
                   287 >KF790290,A/Alabama/18/2012(H3N2))6 neuraminidase (NA) gene                ................................A..........................................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       21     21 ,     21     21     287:>KF790290,A/Alabama/18/2012(H3N2))6 neuraminidase (NA) gene                
                   288 >KF790481,A/West Virginia/05/2013(H3N2))6 neuraminidase (NA) gene          ...........................................................................C....A..G....C...............................CA...R........T....G..............................G....C..T..................A....................AT..............C.........................................................A..A..C......................T....G....................T.................C......       23     23 ,     23     23     288:>KF790481,A/West Virginia/05/2013(H3N2))6 neuraminidase (NA) gene          
                   289 >KF789967,A/West Virginia/10/2013(H3N2))6 neuraminidase (NA) gene          ...........................................................................C....A..G....C...............................CA...R........T....G..............................G....C..T..................A....................AT..............C.........................................................A..A..C......................T....G....................T.................C......       23     23 ,     23     23     289:>KF789967,A/West Virginia/10/2013(H3N2))6 neuraminidase (NA) gene          
                   290 >KF789861,A/West Virginia/11/2013(H3N2))6 neuraminidase (NA) gene          ...........................................................................C....A..G....C...............................CA...R........T....G..............................G....C..T..................A....................AT..............C.........................................................A..A..C......................T....G....................T.................C......       23     23 ,     23     23     290:>KF789861,A/West Virginia/11/2013(H3N2))6 neuraminidase (NA) gene          
                   291 >KF790485,A/West Virginia/06/2013(H3N2))6 neuraminidase (NA) gene          ...........................................................................C....A..G....C...............................CA............T....G..............................G....C..T..................A....................AT..............C.........................................................A..A..C......................T....G....................T.................C......       22     22 ,     22     22     291:>KF790485,A/West Virginia/06/2013(H3N2))6 neuraminidase (NA) gene          
                   292 >KF790235,A/New York/38/2012(H3N2))6 neuraminidase (NA) gene               ...........................................................................C.......G....C................................A............T....G....................T.........G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       19     19 ,     19     19     292:>KF790235,A/New York/38/2012(H3N2))6 neuraminidase (NA) gene               
                   293 >KF790269,A/New York/38/2012(H3N2))6 neuraminidase (NA) gene               ...........................................................................C.......G....C................................A.Y..........T....G....................T.........G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     293:>KF790269,A/New York/38/2012(H3N2))6 neuraminidase (NA) gene               
                   294 >KF789943,A/California/49/2012(H3N2))6 neuraminidase (NA) gene             ...........................................................................C.......G....C...............................CA.Y.R........T....G..............................G.......T..................A..........A.........AT..............C......C..................................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     294:>KF789943,A/California/49/2012(H3N2))6 neuraminidase (NA) gene             
                   295 >KF790239,A/Hawaii/30/2012(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C.......G....C........A.......................A...R........T....G..............................G.......T..................A..........A.........AT..............C......C..................................................A..A..C...........................G....................T.................C......       22     22 ,     22     22     295:>KF790239,A/Hawaii/30/2012(H3N2))6 neuraminidase (NA) gene                 
                   296 >KF789910,A/Hawaii/45/2012(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C.......G....C................................A...A........T....G..............................G.......T..................A..........A.........AT..............C......C..................................................A..A..C...........................G....................T.................C......       21     21 ,     21     21     296:>KF789910,A/Hawaii/45/2012(H3N2))6 neuraminidase (NA) gene                 
                   297 >KF790179,A/Hawaii/28/2012(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C.......G....C................................A............T....G..............................G.......T..................A..........A.........AT..............C......C..................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     297:>KF790179,A/Hawaii/28/2012(H3N2))6 neuraminidase (NA) gene                 
                   298 >KF790283,A/Hawaii/29/2012(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C.......G....C................................A....R.......T....G..Y...........................G.......T..................A..........A.........AT..............C......C..................................................A..A..C...........................G....................T.................C......       22     22 ,     22     22     298:>KF790283,A/Hawaii/29/2012(H3N2))6 neuraminidase (NA) gene                 
                   299 >KF790494,A/Pennsylvania/21/2012(H3N2))6 neuraminidase (NA) gene           ...........................................................................C.......G..C.C................................A....R.......T....G..............................G.......T......T...........A....................AT..............C........Y................................................A..A..C...........................G............A.......T.................C......       23     23 ,     23     23     299:>KF790494,A/Pennsylvania/21/2012(H3N2))6 neuraminidase (NA) gene           
                   300 >KF789994,A/Hawaii/26/2012(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C.......G....C................................A....R.......T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       19     19 ,     19     19     300:>KF789994,A/Hawaii/26/2012(H3N2))6 neuraminidase (NA) gene                 
                   301 >KF789986,A/Hawaii/25/2012(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C.......G....C................................A............T....G.........R....................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       19     19 ,     19     19     301:>KF789986,A/Hawaii/25/2012(H3N2))6 neuraminidase (NA) gene                 
                   302 >KF790431,A/Massachusetts/07/2012(H3N2))6 neuraminidase (NA) gene          ...........................................................................C.......G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       18     18 ,     18     18     302:>KF790431,A/Massachusetts/07/2012(H3N2))6 neuraminidase (NA) gene          
                   303 >KF790252,A/New Hampshire/12/2012(H3N2))6 neuraminidase (NA) gene          ...........................................................................C.......G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       18     18 ,     18     18     303:>KF790252,A/New Hampshire/12/2012(H3N2))6 neuraminidase (NA) gene          
                   304 >KF789988,A/Hawaii/26/2012(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C.......G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       18     18 ,     18     18     304:>KF789988,A/Hawaii/26/2012(H3N2))6 neuraminidase (NA) gene                 
                   305 >KF789873,A/New Hampshire/11/2012(H3N2))6 neuraminidase (NA) gene          ...........................................................................C.......G....C................................A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       18     18 ,     18     18     305:>KF789873,A/New Hampshire/11/2012(H3N2))6 neuraminidase (NA) gene          
                   306 >KF789930,A/New Hampshire/11/2012(H3N2))6 neuraminidase (NA) gene          ...........................................................................C.......G....C................................A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       19     19 ,     19     19     306:>KF789930,A/New Hampshire/11/2012(H3N2))6 neuraminidase (NA) gene          
                   307 >KF790002,A/Hawaii/25/2012(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C.......G....C................................A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       19     19 ,     19     19     307:>KF790002,A/Hawaii/25/2012(H3N2))6 neuraminidase (NA) gene                 
                   308 >KF790467,A/New Mexico/03/2013(H3N2))6 neuraminidase (NA) gene             ...........................................................................C.......G....C................................A...R........T....G..............................G......CT..................A....................AT..............C.........................................................A..A..C...........................G.............A......T.................C......       21     21 ,     21     21     308:>KF790467,A/New Mexico/03/2013(H3N2))6 neuraminidase (NA) gene             
                   309 >KF790249,A/Texas/82/2012(H3N2))6 neuraminidase (NA) gene                  ...........................................................................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     309:>KF790249,A/Texas/82/2012(H3N2))6 neuraminidase (NA) gene                  
                   310 >KF790363,A/District Of Columbia/01/2013(H3N2))6 neuraminidase (NA) gene   ...........................................................................C....A..G....C................................A...R........T....G..............................G.......T..................A....................AT..............C...........C.............................................A..A..C...........................G....................T..........A......C......       22     22 ,     22     22     310:>KF790363,A/District Of Columbia/01/2013(H3N2))6 neuraminidase (NA) gene   
                   311 >KF790122,A/Alaska/03/2013(H3N2))6 neuraminidase (NA) gene                 ...........................................................................C....A..G....C................................A...R........T....G...............C..............G.......T..................A...........A........AT..............C.........................................................A..A..C...........................G....................T.................C......       22     22 ,     22     22     311:>KF790122,A/Alaska/03/2013(H3N2))6 neuraminidase (NA) gene                 
                   312 >KF789568,A/Massachusetts/06/2013(H3N2))6 neuraminidase (NA) gene          ...........................................................................C....A..G....C................................A...R........T....G...............C..............G.......T..................A...........A........AT..............C.........................................................A..A..C...........................G....................TG................C......       23     23 ,     23     23     312:>KF789568,A/Massachusetts/06/2013(H3N2))6 neuraminidase (NA) gene          
                   313 >KF790025,A/Wisconsin/08/2013(H3N2))6 neuraminidase (NA) gene              ...........................................................................C....A..G....C.................C..............A...R........T....G..............C...............G.......T..................A.....................T..............C.........................................................A..A..C...........................G....................TG................C......       22     22 ,     22     22     313:>KF790025,A/Wisconsin/08/2013(H3N2))6 neuraminidase (NA) gene              
                   314 >KF790052,A/North Dakota/02/2013(H3N2))6 neuraminidase (NA) gene           ...........................................................................C....A..G....C.................C..............A...R........T....G..............................G.....G.T..................A....................AT..............C.........................................................A..A..C...........................G...C................TG................C......       24     24 ,     24     24     314:>KF790052,A/North Dakota/02/2013(H3N2))6 neuraminidase (NA) gene           
                   315 >KF789836,A/California/18/2013(H3N2))6 neuraminidase (NA) gene             ...........................................................................C....A..G....C.................C..............A.Y.R........T....G..............................G.....G.T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     315:>KF789836,A/California/18/2013(H3N2))6 neuraminidase (NA) gene             
                   316 >KF789823,A/New York/47/2012(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C.................C..............A...R........T....G..............................G.......T..................A....................AT..............C........................................R................A..A..C...........................G....................T.................C......       22     22 ,     22     22     316:>KF789823,A/New York/47/2012(H3N2))6 neuraminidase (NA) gene               
                   317 >KF789729,A/New Mexico/06/2013(H3N2))6 neuraminidase (NA) gene             ...........................................................................C....A..G....C.................C..............A...R........T..A.G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       22     22 ,     22     22     317:>KF789729,A/New Mexico/06/2013(H3N2))6 neuraminidase (NA) gene             
                   318 >KF789607,A/Wyoming/03/2013(H3N2))6 neuraminidase (NA) gene                ...........................................................................C....A..G....C.................C..............A...R........T....G..............................G.......T..................A....................AT..A...........C.......................................................A.A..A..C...........................G....................T.................C......       23     23 ,     23     23     318:>KF789607,A/Wyoming/03/2013(H3N2))6 neuraminidase (NA) gene                
                   319 >KF789863,A/New Jersey/05/2013(H3N2))6 neuraminidase (NA) gene             ...............................................................A...........C....A..G....C.................CA.............A...R........T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     319:>KF789863,A/New Jersey/05/2013(H3N2))6 neuraminidase (NA) gene             
                   320 >KF790042,A/Florida/09/2013(H3N2))6 neuraminidase (NA) gene                .C.........................................................................C....A..G....C.................C..............A...R........T....G.............T................G.......T..................A....................AT....C.........C.........................................................A..A..C...........................G....................T.................C......       24     24 ,     24     24     320:>KF790042,A/Florida/09/2013(H3N2))6 neuraminidase (NA) gene                
                   321 >KF790318,A/Massachusetts/04/2013(H3N2))6 neuraminidase (NA) gene          ...........................................................................C....A..G....C..........R......C..............A...R........T...CG..............................G.......T..................A....................AT..............C........................T................................A..A..C...........................G....................T.................C......       24     24 ,     24     24     321:>KF790318,A/Massachusetts/04/2013(H3N2))6 neuraminidase (NA) gene          
                   322 >KF790533,A/Iowa/02/2013(H3N2))6 neuraminidase (NA) gene                   ...........................................................................C....A..G....C.................C..............A...R........T....G..............................G.......T..................A....................AT.........AA...C.................................................G.......A..A..C...........................G....................T.................C......       24     24 ,     24     24     322:>KF790533,A/Iowa/02/2013(H3N2))6 neuraminidase (NA) gene                   
                   323 >KF790410,A/Delaware/08/2013(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C.................C..............A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     323:>KF790410,A/Delaware/08/2013(H3N2))6 neuraminidase (NA) gene               
                   324 >KF789897,A/Massachusetts/15/2012(H3N2))6 neuraminidase (NA) gene          ...........................................................................C....A..G....C.................C..............A............T....G..............................G.......T..................A..G.................AT..............C.........................................................A..A..C...........................G....................T.................C......       21     21 ,     21     21     324:>KF789897,A/Massachusetts/15/2012(H3N2))6 neuraminidase (NA) gene          
                   325 >KF790317,A/New Jersey/02/2013(H3N2))6 neuraminidase (NA) gene             ...........................................................................C....A..G....C.................C..............A............T....G...............C..............G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       21     21 ,     21     21     325:>KF790317,A/New Jersey/02/2013(H3N2))6 neuraminidase (NA) gene             
                   326 >KF789747,A/Texas/09/2013(H3N2))6 neuraminidase (NA) gene                  .................................................G.........................C....A..G....C.................C..............A............T....G..........................A...G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       22     22 ,     22     22     326:>KF789747,A/Texas/09/2013(H3N2))6 neuraminidase (NA) gene                  
                   327 >KF790021,A/Florida/08/2013(H3N2))6 neuraminidase (NA) gene                ...........................................................................C....A..G....C.................C..............A............T....G..............................G.......T..................A................C...AT..............C...................................R.....................A..A..C...........................G....................T.................C......       22     22 ,     22     22     327:>KF790021,A/Florida/08/2013(H3N2))6 neuraminidase (NA) gene                
                   328 >KF790422,A/Massachusetts/05/2013(H3N2))6 neuraminidase (NA) gene          ...........................................................................C....A..G....C.................C..............A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       20     20 ,     20     20     328:>KF790422,A/Massachusetts/05/2013(H3N2))6 neuraminidase (NA) gene          
                   329 >KF790024,A/New York/05/2013(H3N2))6 neuraminidase (NA) gene               ..........................................C................................C....A..G....C.................C..............A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       21     21 ,     21     21     329:>KF790024,A/New York/05/2013(H3N2))6 neuraminidase (NA) gene               
                   330 >KF790372,A/New York/06/2013(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G....C.................C..............A............T....G..............................G.......T..................A.....................T..............C.........................................................A..A..C...........................G....................T.................C......       19     19 ,     19     19     330:>KF790372,A/New York/06/2013(H3N2))6 neuraminidase (NA) gene               
                   331 >KF789536,A/Florida/06/2013(H3N2))6 neuraminidase (NA) gene                ...........................................................................C....A..G....C.................C..............A............T....G..............................G.......T..................A....................AT..............C.........................................................A..A..C..........T................G....................T.................C......       21     21 ,     21     21     331:>KF789536,A/Florida/06/2013(H3N2))6 neuraminidase (NA) gene                
                   332 >KC892571,A/Pennsylvania/09/2012(H3N2))6 neuraminidase (NA) gene           ..............................................................T..........G.CA...A..G....C................................A............T....G..................A...........G.......T..................A....................AT..............C.........................................................A..A..C..........T................G....................T...C.............C......       25     25 ,     25     25     332:>KC892571,A/Pennsylvania/09/2012(H3N2))6 neuraminidase (NA) gene           
                   333 >KF789694,A/Pennsylvania/09/2012(H3N2))6 neuraminidase (NA) gene           ..............................................................T..........G.CA...A..G....C................................A............T....G..................A...........G.......T..................A....................AT..............C.........................................................A..A..C..........T................G....................T...C.............C......       25     25 ,     25     25     333:>KF789694,A/Pennsylvania/09/2012(H3N2))6 neuraminidase (NA) gene           
                   334 >KF790314,A/Delaware/07/2013(H3N2))6 neuraminidase (NA) gene               ...............................................GG..........................C....A..G....C......................T.........A............T....G..............................G.......T............G.....A....................AT..............C.........................................................A..A..C...........................G....................T.................C......       23     23 ,     23     23     334:>KF790314,A/Delaware/07/2013(H3N2))6 neuraminidase (NA) gene               
                   335 >KF789931,A/Maryland/29/2012(H3N2))6 neuraminidase (NA) gene               ..........................................................................TC....A.......C................................A....R.......T....G..............................G.......T..................A.............T......AT..............C.........................................................A..A..C...........................G....................T...............TAC......       23     23 ,     23     23     335:>KF789931,A/Maryland/29/2012(H3N2))6 neuraminidase (NA) gene               
                   336 >KF789971,A/Florida/21/2013(H3N2))6 neuraminidase (NA) gene                ...........................................................................C....A..G...........T.....................T...A....R....T..TT..................................G.......T..................A.....TC..............T...........................C.G..............G...........................A..A..C...........................G..............T.....T.................C......       26     26 ,     26     26     336:>KF789971,A/Florida/21/2013(H3N2))6 neuraminidase (NA) gene                
                   337 >KF790142,A/Texas/14/2013(H3N2))6 neuraminidase (NA) gene                  ............................G..............................................C....A..G.................................T...A....R....T..TT..................................G.......T..................A.....T...............T...........................C.G....................A.....................A..A..C...........................G..............T.....T.................C......       25     25 ,     25     25     337:>KF790142,A/Texas/14/2013(H3N2))6 neuraminidase (NA) gene                  
                   338 >KF789973,A/Massachusetts/12/2013(H3N2))6 neuraminidase (NA) gene          ...........................................................................C....A..G.................................T...A....R....T..TT.................T................G.......T..................A.....T...............T........G..................C.G..........................................A..A..C...........................G..............T.....T.................C......       25     25 ,     25     25     338:>KF789973,A/Massachusetts/12/2013(H3N2))6 neuraminidase (NA) gene          
                   339 >KF790380,A/Missouri/05/2013(H3N2))6 neuraminidase (NA) gene               ...........................................................................C....A..G.................................T...A...R.....T..TT..................................G.......T..................A..G..T...............T...........................C.G..........................................A..A..C...........................G..............T..C..T.................C......       25     25 ,     25     25     339:>KF790380,A/Missouri/05/2013(H3N2))6 neuraminidase (NA) gene               
                   340 >KF790299,A/Massachusetts/13/2013(H3N2))6 neuraminidase (NA) gene          ...........................................................................C....A..G.................................T...A...R.....T..TT..................................G.......T..................A.....T...............T...........................C.G..........................................A..A..C...........................G..............T.....T.................C......       23     23 ,     23     23     340:>KF790299,A/Massachusetts/13/2013(H3N2))6 neuraminidase (NA) gene          
                   341 >Index/H3N2-2011-normalEI/2011(H3N2)                                       ........................................G.......................................A........................................A.......................................A........G.......T..................A.....................T........................A...............................................A..A..C...G.....................A......................T.................C......       16     16 ,     16     16     341:>Index/H3N2-2011-normalEI/2011(H3N2)                                       
                   342 >Index/2009/Egypt-Iowa+NA,2009//                                           .........................................................................................................................A................................................G................................................T...........................................................................A..C................................................T.................C......        7      7 ,      7      7     342:>Index/2009/Egypt-Iowa+NA,2009//                                           
                   343 >KF765544,A/Finland/584/2009(H3N2))6 neuraminidase (NA) gene               ...............................................................................G.........................................A................................................G...............C................................T..........................................................................................A................................A...T.................C......        9      9 ,      9      9     343:>KF765544,A/Finland/584/2009(H3N2))6 neuraminidase (NA) gene               
                   344 >KF765550,A/Finland/97/2009(H3N2))6 neuraminidase (NA) gene                .........................................................................................................................A................................................G...............C................................T..........................................................................................A....................................T.................C......        7      7 ,      7      7     344:>KF765550,A/Finland/97/2009(H3N2))6 neuraminidase (NA) gene                
                   345 >KF765539,A/Finland/636/2009(H3N2))6 neuraminidase (NA) gene               .............A.........................................................................G...............................A.A................................................G................................................T.............A.....G....................................................................................................................................        8      8 ,      8      8     345:>KF765539,A/Finland/636/2009(H3N2))6 neuraminidase (NA) gene               
                   346 >KF765546,A/Finland/98/2009(H3N2))6 neuraminidase (NA) gene                .......................................................................................G...............................A.A................................................G................................................T.............A.....G....................................................................................................................................        7      7 ,      7      7     346:>KF765546,A/Finland/98/2009(H3N2))6 neuraminidase (NA) gene                
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       
                  ---Index------------------------------------------------------------------------TTAAGTTCTAATGCTGTTACTGATCTTCATAGCACTCACGAAATAAGAAATGACGCCCCCAAAGAGAATCCCAACTGAAAGGAACAAATTGTGGTCGGCGGAACTCTGAAGCTCGAACGGTGCCTGATGCTAGACCAGTATTTCGGCGAGATTCTTGGGTATCTCGGGTAATAAGAATCCGCGGACTTCAATTAAAGGTAAAAATTACGGACGTTGACGCCTCATTGCAGCAACAGCCGAGTATTGTTCATGGAAAAAAGCCCAAGCTTTGATCTGAGTGTTAGACTAGGGAGTCGCGAGACAGACCGACCTAGCTATGGACGCGTAAGTTACTTAGAGCGCGGTGAAAAGTAACGGGCCTTTGGATCCCAT 
                  -codon-position-----------------------------------------------------------------  11 2    122 2 2 1 1 1 2 1  121 1 1  1   121 1 1 2 21 2    1 2 1 1 1 1 2 121 1    2 1          1  1 2   1 122   1    1  1 2212   12 1 1  1    1              1    1  2   121 1 12           1   1       1 2  11    1 122     1 1 2  1 2  1   1   12 12  1 1    2212 2 1121  112   1 1 2        1    2 2  2     2  12 2 2  1122   1 2 11   1    1 2     1 1  1  2   1    11  1  1212 
                                                                                                  000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 
                                                                                                  000000000000000000000000001111111111111111111111111122222222222222222222222222222222222233333333333333333333333344444444444444444444444444444555555555555555555566666666666666666666666666666777777777777777777777777788888888888888888888899999999999999999999999999990000000000000000000000000000000011111111111111111111111111111122222222222222222222222222333333333333333334444 
                                                                                                  011223345555667777888889990111122223345566677777788900000111112222233333344445566777788800011222333445677777888900012222334445555566667778889000011112444557888900111223334456666666777889999000111223344445556678888900122344445556667889900002233333334444566888999990000011112222233334445567788999900000111122344555666677888899900001223333444466777778999000013344556889990000 
                                                                                                  626578951789261278245783563178916790574658902457805202467036791235912457901245647038935803625147169686925689034926870679891361236934891246798145703692369259589139235790363780134569258140369058124032814572360370367229858706790271480781803671404567892359109136123560346812560367905781470921806257801467036918712578014845125827934798150369057803256891016245810547379360582356



                  segment 7:


                  Code:
                                                                              000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 
                                                                              000000000001111111111111111112222222222222222333333333333333344444444444444444444555555555555555566666666666666667777777777777777777888888888888888888888899999999999 
                                                                              334444568990012455666778888890144455666779999000112233555899900112234556777888899012224444556789900000112233457781223455666667788899022334444445556677888911234555677 
                                                                              690358197392812409378570356957606958147361357369254803124108928140681698147037926141580136254321403469281502222851035468023675801203839890346780593714256829530026749 
                  -codon-position---------------------------------------------  11          2   12 1   2                21       1   1   2                 1  1 12   1           1     1 2 1  1      21 11211 121111112  1 121 12 11  11 11 1212121 
                  ---Index----------------------------------------------------CTAGTAAGACTGCACAAACCTATGGTTGGCACTCTGTATTCTACGGATGGGCTGCATCCATGGTATGGAGGCCGCGTAGAGATGTGTTGCTATAAGGGGGCGGTTGGAGGTTCGTGGGGGCCGTGCGATAGCGTTCGTATGACCACCAACCAAGAAAAGGCCCTG 
                     1 >Index/USA-2007                                        .....................................................................................................................................................................        0      0 ,      0      0       1:>Index/USA-2007                                        
                     2 >Index/Perth-like/2009                                 ......................................C........................................G...A...........A................T....................................................        5      5 ,      5      5       2:>Index/Perth-like/2009                                 
                     3 >Index/Brisbane-like/2007                              .....................................................................................................................................................................        0      0 ,      0      0       3:>Index/Brisbane-like/2007                              
                     4 >2007/02/06,14278,AUS,A/Brisbane/10/07                 ........................................................C.............................C..............................................................................        2      2 ,      2      2       4:>2007/02/06,14278,AUS,A/Brisbane/10/07                 
                     5 >Index/2009/Egypt/Iowa                                 ......................................C........................................G...A.................................................................................        3      3 ,      3      3       5:>Index/2009/Egypt/Iowa                                 
                     6 >Index/H3N2-2011-normalEI/2011(H3N2)                   ......................................C..........................C.............G...A.......T..G..............................................................G.......        7      7 ,      7      7       6:>Index/H3N2-2011-normalEI/2011(H3N2)                   
                     7 >Index/2009/Egypt-Iowa+NA,2009//                       ......................................C........................................G...A.................................................................................        3      3 ,      3      3       7:>Index/2009/Egypt-Iowa+NA,2009//                       
                     8 >Index/32g12f1.c2,42-53                                ......................................C..C.........................A...........G...A.........................A..........................A............................        7      7 ,      7      7       8:>Index/32g12f1.c2,42-53                                
                     9 >KF790507,A/Texas/83/2012(H3N2)                        ......................................C..C.........................A...........G...A.........................A..........................A............................        7      7 ,      7      7       9:>KF790507,A/Texas/83/2012(H3N2)                        
                    10 >KF790172,A/Louisiana/09/2012(H3N2)                    ......................................C..C.........................A...........G...A.................................................................................        5      5 ,      5      5      10:>KF790172,A/Louisiana/09/2012(H3N2)                    
                    11 >KF790254,A/Maine/08/2012(H3N2)                        ................................CT....C..C.........................A...........G...A.............A...................................C.........................A.....       10     10 ,     10     10      11:>KF790254,A/Maine/08/2012(H3N2)                        
                    12 >Index/32g12f1.c2,38-41                                ......................................C..C.........................A...........G...A..................A....................A.........................................        7      7 ,      7      7      12:>Index/32g12f1.c2,38-41                                
                    13 >KF790174,A/Maryland/32/2012(H3N2)                     ......................................C..C.........................A...........G...A.....T...........................................................................        6      6 ,      6      6      13:>KF790174,A/Maryland/32/2012(H3N2)                     
                    14 >KF789708,A/Kentucky/18/2012(H3N2)                     .......A.....................A........C.T........A.............................G..CA.....A..............................T..........T.................................       11     11 ,     11     11      14:>KF789708,A/Kentucky/18/2012(H3N2)                     
                    15 >KF789710,A/Kentucky/17/2012(H3N2)                     .......A.....................A........C.T........A.............................G...A.....A..............................T..........T.................................       10     10 ,     10     10      15:>KF789710,A/Kentucky/17/2012(H3N2)                     
                    16 >KF790486,A/South Carolina/22/2012(H3N2)               .......A.....................A........C.T........A.............................G...A.....A..............................T..........T.................................       10     10 ,     10     10      16:>KF790486,A/South Carolina/22/2012(H3N2)               
                    17 >KF789907,A/Kentucky/24/2012(H3N2)                     .......A.....................A........C.T........A.............................G...A.....A..............................T..........T.................................       10     10 ,     10     10      17:>KF789907,A/Kentucky/24/2012(H3N2)                     
                    18 >KF789939,A/South Carolina/24/2012(H3N2)               .......A.....................A........C.T........A.............................G...A.....A..............................T..........T.................................       10     10 ,     10     10      18:>KF789939,A/South Carolina/24/2012(H3N2)               
                    19 >KF790428,A/Tennessee/10/2012(H3N2)                    .......A.....................A........C.T........A.............................G...A.....A..............................T..........T.................................       10     10 ,     10     10      19:>KF790428,A/Tennessee/10/2012(H3N2)                    
                    20 >KF789932,A/South Carolina/24/2012(H3N2)               .......A.....................A........C.T........A.............................G...A.....A..............................T..........T.................................       10     10 ,     10     10      20:>KF789932,A/South Carolina/24/2012(H3N2)               
                    21 >KF789802,A/Virginia/16/2012(H3N2)                     .......A.....................A........C.T........A.............................G...A.....A..........................A...T..........T.................................       11     11 ,     11     11      21:>KF789802,A/Virginia/16/2012(H3N2)                     
                    22 >KF789675,A/Virginia/15/2012(H3N2)                     .......A.....................A........C.T........A.............................G...A.....A..........................A...T..........T.................................       11     11 ,     11     11      22:>KF789675,A/Virginia/15/2012(H3N2)                     
                    23 >KF789803,A/Virginia/16/2012(H3N2)                     .......A.....................A........C.T........A.............................G...A.....A..........................A...T..........T.................................       11     11 ,     11     11      23:>KF789803,A/Virginia/16/2012(H3N2)                     
                    24 >KF789757,A/Michigan/33/2012(H3N2)                     .......A.....................A........C.T........A.............................G...A.....A..........................A...T..........T.................................       11     11 ,     11     11      24:>KF789757,A/Michigan/33/2012(H3N2)                     
                    25 >KF789713,A/Tennessee/18/2012(H3N2)                    .......A.....................A........C.T........A.............................G...A.....A..........................A...T..........T.................................       11     11 ,     11     11      25:>KF789713,A/Tennessee/18/2012(H3N2)                    
                    26 >KF789940,A/Florida/68/2012(H3N2)                      .............................A........C.T........A.............................G...A.....A..............................T............................................        8      8 ,      8      8      26:>KF789940,A/Florida/68/2012(H3N2)                      
                    27 >KF790424,A/Alaska/02/2013(H3N2)                       .............................A........C.T........A.....................T.......G...A.....A.............................................TA........T...................       11     11 ,     11     11      27:>KF790424,A/Alaska/02/2013(H3N2)                       
                    28 >KF789808,A/Georgia/22/2012(H3N2)                      .............................A........C.T........A.....................T.......G...A.....A.............................................TA........T...................       11     11 ,     11     11      28:>KF789808,A/Georgia/22/2012(H3N2)                      
                    29 >KF789903,A/Alaska/02/2013(H3N2)                       .............................A........C.T........A.....................T.......G...A.....A.............................................TA........T...................       11     11 ,     11     11      29:>KF789903,A/Alaska/02/2013(H3N2)                       
                    30 >KF789937,A/Florida/01/2013(H3N2)                      .............................A........C.T........A.....................T.......G...A.....A.............................................TA........T...................       11     11 ,     11     11      30:>KF789937,A/Florida/01/2013(H3N2)                      
                    31 >KF789553,A/California/55/2012(H3N2)                   .............................A........C.T........A.....................T.......G...A.....A.............................................TA........T...................       11     11 ,     11     11      31:>KF789553,A/California/55/2012(H3N2)                   
                    32 >KF790246,A/South Carolina/16/2012(H3N2)               .............................A........C.T........A.....................T.......G...A.....A......................................C......TA........T...................       12     12 ,     12     12      32:>KF790246,A/South Carolina/16/2012(H3N2)               
                    33 >KF790078,A/Delaware/23/2012(H3N2)                     .........A...................A........C.T........A.....................T.......G...A.....A..............................................A........T...................       11     11 ,     11     11      33:>KF790078,A/Delaware/23/2012(H3N2)                     
                    34 >KF790072,A/Delaware/23/2012(H3N2)                     .........A...................A........C.T........A.....................T.......G...A.....A..............................................A........T...................       11     11 ,     11     11      34:>KF790072,A/Delaware/23/2012(H3N2)                     
                    35 >KF790274,A/Mississippi/13/2012(H3N2)                  .............................A........C.T........A.....................T.......G...A.....A..............................................A........T...................       10     10 ,     10     10      35:>KF790274,A/Mississippi/13/2012(H3N2)                  
                    36 >KF790191,A/Vermont/16/2012(H3N2)                      .............................A........C.T........A.....................T.......G...A.....A..............................................A........T...................       10     10 ,     10     10      36:>KF790191,A/Vermont/16/2012(H3N2)                      
                    37 >KF790241,A/New York/40/2012(H3N2)                     .............................A........C.T........A.....................T.......G...A.....A.......A.................A....................A........T...................       12     12 ,     12     12      37:>KF790241,A/New York/40/2012(H3N2)                     
                    38 >KF790233,A/Nevada/26/2012(H3N2)                       .............................A........C.T........A.....................T.......G...A.....A.......A......................................A........T...................       11     11 ,     11     11      38:>KF790233,A/Nevada/26/2012(H3N2)                       
                    39 >KF789860,A/Maryland/43/2012(H3N2)                     .............................A........C.T........A.....................T.......G...A.....A.......A......................................A........T...................       11     11 ,     11     11      39:>KF789860,A/Maryland/43/2012(H3N2)                     
                    40 >KF789749,A/Louisiana/16/2012(H3N2)                    .............................A........C.T........A.....................T.......G...A.....A.......A......................................A........T...................       11     11 ,     11     11      40:>KF789749,A/Louisiana/16/2012(H3N2)                    
                    41 >KF789919,A/Alabama/35/2012(H3N2)                      .............................A........C.T........A.....................T.......G...A.....A.......A......................................A........T...................       11     11 ,     11     11      41:>KF789919,A/Alabama/35/2012(H3N2)                      
                    42 >KF790000,A/Florida/39/2012(H3N2)                      .............................A........C.T........A.....................T.......G...A.....A.......A...A..................................A........T...................       12     12 ,     12     12      42:>KF790000,A/Florida/39/2012(H3N2)                      
                    43 >KF789833,A/Virginia/14/2012(H3N2)                     .............................A........C.T........A.....................T.......GA..A.....A.......A......................................A........T...................       12     12 ,     12     12      43:>KF789833,A/Virginia/14/2012(H3N2)                     
                    44 >KF790096,A/Wisconsin/37/2012(H3N2)                    ......................C......A........C.T........A.....................T.......G...A.....A..............................................A........T...................       11     11 ,     11     11      44:>KF790096,A/Wisconsin/37/2012(H3N2)                    
                    45 >KF790110,A/Mississippi/12/2012(H3N2)                  ......................C......A........C.T........A.....................T.......G...A.....A.........S....................................A........T...............A...       13     13 ,     13     13      45:>KF790110,A/Mississippi/12/2012(H3N2)                  
                    46 >KF790396,A/Nebraska/04/2013(H3N2)                     ......................C......A....C...C.T........A.....................T.......G...A.....A...............A..............................A........T...................       13     13 ,     13     13      46:>KF790396,A/Nebraska/04/2013(H3N2)                     
                    47 >Index/32g12f1.c2,55-62                                .............................A....C...C.T........AA....................T.......G...A.....A..............................................A........T...................       12     12 ,     12     12      47:>Index/32g12f1.c2,55-62                                
                    48 >KF789573,A/Colorado/20/2012(H3N2)                     .............................A........C.T........AA....................T.......G...A.....A..............................................A........T....T..............       12     12 ,     12     12      48:>KF789573,A/Colorado/20/2012(H3N2)                     
                    49 >KF789692,A/Georgia/15/2012(H3N2)                      .............................A........C.T........A.....................T.....C.G...A.....A..............................................A........T...................       11     11 ,     11     11      49:>KF789692,A/Georgia/15/2012(H3N2)                      
                    50 >KF789922,A/Georgia/16/2012(H3N2)                      .............................A........C.T........A.....................T.....C.G...A.....A..............................................A........T........G..........       12     12 ,     12     12      50:>KF789922,A/Georgia/16/2012(H3N2)                      
                    51 >Index/H3N3-2011-reassortedEI/2011(H3N2)               .............................A........C.T........A.............................G...A.....A...........................................................................        7      7 ,      7      7      51:>Index/H3N3-2011-reassortedEI/2011(H3N2)               
                    52 >KF790164,A/Oklahoma/04/2012(H3N2)                     .........T......T..T.....G...A........C.T........A.....G.......................G...A.....A...................T.............................C....................A.T..       16     16 ,     16     16      52:>KF790164,A/Oklahoma/04/2012(H3N2)                     
                    53 >KF790492,A/Louisiana/11/2012(H3N2)                    ..........G..................A........C.T........A....................A.T......G...A.....A................A...................T.......C.............G................       14     14 ,     14     14      53:>KF790492,A/Louisiana/11/2012(H3N2)                    
                    54 >KF790474,A/California/22/2013(H3N2)                   ..................T....A...T..........C.............C...............G..T....C..G...A.............A........A................................................G.........       13     13 ,     13     13      54:>KF790474,A/California/22/2013(H3N2)                   
                    55 >KF789755,A/Michigan/32/2012(H3N2)                     ..................T....A...T..........C.............C...............G..T.......G...A......................................................G..........................       10     10 ,     10     10      55:>KF789755,A/Michigan/32/2012(H3N2)                     
                    56 >KF789864,A/Minnesota/05/2013(H3N2)                    ..................T....A...T..........C.............C...............G..T.......G...A.............................A...................................................       10     10 ,     10     10      56:>KF789864,A/Minnesota/05/2013(H3N2)                    
                    57 >KF790046,A/Georgia/03/2013(H3N2)                      ....C.............T....A...T..........C.............C...............G..T.......G...A..............A..................................................................       11     11 ,     11     11      57:>KF790046,A/Georgia/03/2013(H3N2)                      
                    58 >KF790140,A/Georgia/03/2013(H3N2)                      ....C.............T....A...T..........C.............C...............G..T.......G...A..............A..................................................................       11     11 ,     11     11      58:>KF790140,A/Georgia/03/2013(H3N2)                      
                    59 >KF789882,A/Maine/11/2012(H3N2)                        ..................T....A...T..........C.............C...............G..T.......G...A....................C........................................T...................       11     11 ,     11     11      59:>KF789882,A/Maine/11/2012(H3N2)                        
                    60 >KF789793,A/Illinois/15/2012(H3N2)                     ..................T....A...T..........C.............C...............G..T.......G...A..........................................................T......................       10     10 ,     10     10      60:>KF789793,A/Illinois/15/2012(H3N2)                     
                    61 >KF789723,A/Minnesota/03/2013(H3N2)                    ..................T....A...T..........C.............C...............G..T.......G...A..........................................................T......................       10     10 ,     10     10      61:>KF789723,A/Minnesota/03/2013(H3N2)                    
                    62 >KF790508,A/Ohio/92/2012(H3N2)                         ..................T....A...T..........C.............C...............G..T.......G...A.................................................................................        9      9 ,      9      9      62:>KF790508,A/Ohio/92/2012(H3N2)                         
                    63 >KF790035,A/Nevada/05/2013(H3N2)                       ..................T....A...T..........C.............C...............G..T.......G...A.................................................................................        9      9 ,      9      9      63:>KF790035,A/Nevada/05/2013(H3N2)                       
                    64 >KF790349,A/Mississippi/02/2013(H3N2)                  ..................T....A...T..........C.............C...............G..T.......G...A.................................................................................        9      9 ,      9      9      64:>KF790349,A/Mississippi/02/2013(H3N2)                  
                    65 >KF790475,A/Louisiana/01/2013(H3N2)                    ..................T....A...T..........C.............C...............G..T.......G...A.................................................................................        9      9 ,      9      9      65:>KF790475,A/Louisiana/01/2013(H3N2)                    
                    66 >KF790401,A/Alaska/04/2013(H3N2)                       ..................T....A...T..........C.............C...............G..T.......G...A.................................................................................        9      9 ,      9      9      66:>KF790401,A/Alaska/04/2013(H3N2)                       
                    67 >KF789639,A/Vermont/02/2013(H3N2)                      ..................T....A...T..........C.............C...............G..T.......G...A.................................................................................        9      9 ,      9      9      67:>KF789639,A/Vermont/02/2013(H3N2)                      
                    68 >KF790520,A/California/12/2013(H3N2)                   ..................T....A...T..........C.............C...............G..T.......G...A.................................................................................        9      9 ,      9      9      68:>KF790520,A/California/12/2013(H3N2)                   
                    69 >KF789727,A/Colorado/21/2012(H3N2)                     ..................T....A...T..........C.............C...............G..T.......G...A.................................................................................        9      9 ,      9      9      69:>KF789727,A/Colorado/21/2012(H3N2)                     
                    70 >KF790188,A/Wisconsin/38/2012(H3N2)                    ..................T....A...T..........C.............C...............G..T.......G...A.................................................................................        9      9 ,      9      9      70:>KF790188,A/Wisconsin/38/2012(H3N2)                    
                    71 >KF789641,A/Louisiana/02/2013(H3N2)                    ..................T....A...T..........C.............C...............G..T.......G...A.................................................................................        9      9 ,      9      9      71:>KF789641,A/Louisiana/02/2013(H3N2)                    
                    72 >KF790510,A/Kansas/11/2012(H3N2)                       ..................T....A...T..........C.............C...............G..T.......G...A.................................................................................        9      9 ,      9      9      72:>KF790510,A/Kansas/11/2012(H3N2)                       
                    73 >KF790029,A/New Mexico/09/2013(H3N2)                   ..................T....A...T..........C.............C...............G..T.......G...A.................................................................................        9      9 ,      9      9      73:>KF790029,A/New Mexico/09/2013(H3N2)                   
                    74 >KF789960,A/Illinois/01/2013(H3N2)                     ..................T....A...T..........C.............C...............G..T.......G...A.................................................................................        9      9 ,      9      9      74:>KF789960,A/Illinois/01/2013(H3N2)                     
                    75 >KF790470,A/New Mexico/04/2013(H3N2)                   ..................T....A...T..........C.............C..................T.......G...A.................................................................................        8      8 ,      8      8      75:>KF790470,A/New Mexico/04/2013(H3N2)                   
                    76 >KF789658,A/Oregon/01/2013(H3N2)                       ..................T....A...T..........C.............C..................T.......G...A.................................................................................        8      8 ,      8      8      76:>KF789658,A/Oregon/01/2013(H3N2)                       
                    77 >KF790040,A/Kansas/01/2013(H3N2)                       ..................T....A...T..........C.............C..................T.......G...A.................................................................................        8      8 ,      8      8      77:>KF790040,A/Kansas/01/2013(H3N2)                       
                    78 >KF790303,A/Pennsylvania/02/2013(H3N2)                 ..................T....A...T..........C.............C..................T.......G...A.................................................................................        8      8 ,      8      8      78:>KF790303,A/Pennsylvania/02/2013(H3N2)                 
                    79 >KF790030,A/Michigan/03/2013(H3N2)                     ..................T....A...T..........C.............C..................T.......G...A.................................................................................        8      8 ,      8      8      79:>KF790030,A/Michigan/03/2013(H3N2)                     
                    80 >KF790342,A/Mississippi/01/2013(H3N2)                  ..................T....A...T..........C.............C..................T.......G...A.................................................................................        8      8 ,      8      8      80:>KF790342,A/Mississippi/01/2013(H3N2)                  
                    81 >KF789654,A/Oregon/01/2013(H3N2)                       ..................T....A...T..........C.............C..................T.......G...A.................................................................................        8      8 ,      8      8      81:>KF789654,A/Oregon/01/2013(H3N2)                       
                    82 >KF789737,A/Tennessee/02/2013(H3N2)                    ..................T....A...T..........C.............C..................T.......G...A.........................................A.......................................        9      9 ,      9      9      82:>KF789737,A/Tennessee/02/2013(H3N2)                    
                    83 >KF789537,A/California/14/2013(H3N2)                   ..................T....A...T.........TC.............C..................T.......G...A.................................................................................        9      9 ,      9      9      83:>KF789537,A/California/14/2013(H3N2)                   
                    84 >KF789687,A/Missouri/13/2012(H3N2)                     ..................T....A...T..........C.............C..................T.......G...A............A..............................G.....................................       10     10 ,     10     10      84:>KF789687,A/Missouri/13/2012(H3N2)                     
                    85 >KF790397,A/Wisconsin/05/2013(H3N2)                    ..................T....A...T..........C.............C..................T.......G...A............A....................................................................        9      9 ,      9      9      85:>KF790397,A/Wisconsin/05/2013(H3N2)                    
                    86 >KF790447,A/Wisconsin/41/2012(H3N2)                    ..................T....A...T..........C.............C..................T.......G...A............A....................................................................        9      9 ,      9      9      86:>KF790447,A/Wisconsin/41/2012(H3N2)                    
                    87 >KF790294,A/North Dakota/05/2012(H3N2)                 ..................T....A...T..........C.............C..................T.......G...A........................T........................................................        9      9 ,      9      9      87:>KF790294,A/North Dakota/05/2012(H3N2)                 
                    88 >KF789634,A/Kansas/02/2013(H3N2)                       ..................T....A...T..........C...G.........C...............G..T.......G...A.................................................................................       10     10 ,     10     10      88:>KF789634,A/Kansas/02/2013(H3N2)                       
                    89 >KF789666,A/Kansas/04/2013(H3N2)                       ..................T....A...T..........C.............C...............G..T.......G...A.............................................G...................................       10     10 ,     10     10      89:>KF789666,A/Kansas/04/2013(H3N2)                       
                    90 >KF790305,A/District Of Columbia/01/2012(H3N2)         ..................T....A..CT..........C.............C...............G..T...A...G...A.................................................................................       11     11 ,     11     11      90:>KF790305,A/District Of Columbia/01/2012(H3N2)         
                    91 >KF790083,A/Colorado/01/2013(H3N2)                     ..................T....A..CT..........C.............C...............G..T...A...G...A.................................................................................       11     11 ,     11     11      91:>KF790083,A/Colorado/01/2013(H3N2)                     
                    92 >KF790466,A/California/10/2013(H3N2)                   ..................T....A..CT..........C.............C...............G..T...A...G...A.................................................................................       11     11 ,     11     11      92:>KF790466,A/California/10/2013(H3N2)                   
                    93 >KF789783,A/Nevada/28/2012(H3N2)                       ..................T....A..CT..........C.............C...............G..T.......G...A.................................................................................       10     10 ,     10     10      93:>KF789783,A/Nevada/28/2012(H3N2)                       
                    94 >KF789612,A/Connecticut/01/2013(H3N2)                  ..................T....A...T...T......C.............C...............G..T.......G...A........................................................A........................       11     11 ,     11     11      94:>KF789612,A/Connecticut/01/2013(H3N2)                  
                    95 >KF789745,A/North Carolina/05/2013(H3N2)               ......C................A...T...T......C.............C...............G..T.......G...A..............................C..................................T...............       12     12 ,     12     12      95:>KF789745,A/North Carolina/05/2013(H3N2)               
                    96 >KF790134,A/New York/03/2013(H3N2)                     .......................A...T...T......C.............C...............G..T.......G...A..............................C................................................C.       11     11 ,     11     11      96:>KF790134,A/New York/03/2013(H3N2)                     
                    97 >KF790522,A/California/11/2013(H3N2)                   .......................A...T...T......C.............C...............G..T.......G...A..............................C........................C.........................       11     11 ,     11     11      97:>KF790522,A/California/11/2013(H3N2)                   
                    98 >KF789756,A/Ohio/102/2012(H3N2)                        .......................A...TA..T......C.............C...............G..T.......G...A..............................C..................................................       11     11 ,     11     11      98:>KF789756,A/Ohio/102/2012(H3N2)                        
                    99 >KF790296,A/South Dakota/16/2012(H3N2)                 .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10      99:>KF790296,A/South Dakota/16/2012(H3N2)                 
                   100 >KF790526,A/Idaho/02/2013(H3N2)                        .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     100:>KF790526,A/Idaho/02/2013(H3N2)                        
                   101 >KF789832,A/Nebraska/11/2012(H3N2)                     .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     101:>KF789832,A/Nebraska/11/2012(H3N2)                     
                   102 >KF789790,A/South Dakota/14/2012(H3N2)                 .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     102:>KF789790,A/South Dakota/14/2012(H3N2)                 
                   103 >KF789715,A/Ohio/97/2012(H3N2)                         .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     103:>KF789715,A/Ohio/97/2012(H3N2)                         
                   104 >KF790525,A/Idaho/01/2013(H3N2)                        .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     104:>KF790525,A/Idaho/01/2013(H3N2)                        
                   105 >KF789681,A/South Dakota/10/2012(H3N2)                 .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     105:>KF789681,A/South Dakota/10/2012(H3N2)                 
                   106 >KF789788,A/South Dakota/12/2012(H3N2)                 .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     106:>KF789788,A/South Dakota/12/2012(H3N2)                 
                   107 >KF789830,A/Washington/62/2012(H3N2)                   .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     107:>KF789830,A/Washington/62/2012(H3N2)                   
                   108 >KF790126,A/Missouri/04/2013(H3N2)                     .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     108:>KF790126,A/Missouri/04/2013(H3N2)                     
                   109 >KF790210,A/South Dakota/15/2012(H3N2)                 .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     109:>KF790210,A/South Dakota/15/2012(H3N2)                 
                   110 >KF790300,A/New Mexico/23/2012(H3N2)                   .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     110:>KF790300,A/New Mexico/23/2012(H3N2)                   
                   111 >KF790099,A/Iowa/13/2012(H3N2)                         .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     111:>KF790099,A/Iowa/13/2012(H3N2)                         
                   112 >KF789938,A/California/46/2012(H3N2)                   .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     112:>KF789938,A/California/46/2012(H3N2)                   
                   113 >KF790463,A/Nevada/02/2013(H3N2)                       .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     113:>KF790463,A/Nevada/02/2013(H3N2)                       
                   114 >KF789726,A/Missouri/04/2013(H3N2)                     .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     114:>KF789726,A/Missouri/04/2013(H3N2)                     
                   115 >KF789555,A/California/13/2013(H3N2)                   .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     115:>KF789555,A/California/13/2013(H3N2)                   
                   116 >KF789602,A/West Virginia/20/2012(H3N2)                .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     116:>KF789602,A/West Virginia/20/2012(H3N2)                
                   117 >KF789742,A/South Dakota/01/2013(H3N2)                 .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     117:>KF789742,A/South Dakota/01/2013(H3N2)                 
                   118 >KF789806,A/South Dakota/12/2012(H3N2)                 .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     118:>KF789806,A/South Dakota/12/2012(H3N2)                 
                   119 >KF789942,A/North Dakota/08/2012(H3N2)                 .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     119:>KF789942,A/North Dakota/08/2012(H3N2)                 
                   120 >KF790175,A/Michigan/25/2012(H3N2)                     .......................A...T...T......C.............C...............G..T.......G...A..............................C..................................................       10     10 ,     10     10     120:>KF790175,A/Michigan/25/2012(H3N2)                     
                   121 >KF789955,A/Ohio/01/2013(H3N2)                         .......................A...T...T......C.............C...............G..T.......G...A..............................C.............................G....................       11     11 ,     11     11     121:>KF789955,A/Ohio/01/2013(H3N2)                         
                   122 >KF790376,A/Ohio/01/2013(H3N2)                         .......................A...T...T......C.............C...............G..T.......G...A..............................C.............................G....................       11     11 ,     11     11     122:>KF790376,A/Ohio/01/2013(H3N2)                         
                   123 >KF790443,A/Wyoming/20/2012(H3N2)                      .......................A...T...T......C.............C...............G..T.......G...A..............................C...............................A..................       11     11 ,     11     11     123:>KF790443,A/Wyoming/20/2012(H3N2)                      
                   124 >KF789730,A/Vermont/19/2012(H3N2)                      ....................C..A...T...T......C.............C...............G..T.......G...A..............................C..................................................       11     11 ,     11     11     124:>KF789730,A/Vermont/19/2012(H3N2)                      
                   125 >KF789636,A/Nebraska/06/2013(H3N2)                     .......................A...T...T......C.............................G..T.......G...A......C..........................................................................        9      9 ,      9      9     125:>KF789636,A/Nebraska/06/2013(H3N2)                     
                   126 >KF790304,A/Nebraska/15/2012(H3N2)                     .......................A...T..........C..C..........................G..T.......G...A......C...................................................................A......       10     10 ,     10     10     126:>KF790304,A/Nebraska/15/2012(H3N2)                     
                   127 >KF789647,A/Nebraska/03/2013(H3N2)                     .......................A...T..........C..C..........................G..T.......G...A..........................................................................A......        9      9 ,      9      9     127:>KF789647,A/Nebraska/03/2013(H3N2)                     
                   128 >KF790251,A/Iowa/14/2012(H3N2)                         .......................A...T..........C.............................G..T.......G...A..........................................................................A......        8      8 ,      8      8     128:>KF790251,A/Iowa/14/2012(H3N2)                         
                   129 >KF789577,A/Florida/46/2012(H3N2)                      .......................A...T..........C.............................G..T.......G...A..........................................................................A......        8      8 ,      8      8     129:>KF789577,A/Florida/46/2012(H3N2)                      
                   130 >KF789892,A/New Hampshire/21/2012(H3N2)                .......................A...T..........C.............................G..T.......G...A..........................................................................A......        8      8 ,      8      8     130:>KF789892,A/New Hampshire/21/2012(H3N2)                
                   131 >KF790217,A/Iowa/15/2012(H3N2)                         .......................A...T..........C.............................G..T.......G...A..........................................................................A......        8      8 ,      8      8     131:>KF790217,A/Iowa/15/2012(H3N2)                         
                   132 >KF789890,A/Wisconsin/51/2012(H3N2)                    .......................A...T..........C.............................G..T.......G...A..........................................................................A......        8      8 ,      8      8     132:>KF789890,A/Wisconsin/51/2012(H3N2)                    
                   133 >KF789807,A/Iowa/22/2012(H3N2)                         .......................A...T..........C..............A..............G..T.......G...A..........................................................................A......        9      9 ,      9      9     133:>KF789807,A/Iowa/22/2012(H3N2)                         
                   134 >KF790279,A/Texas/82/2012(H3N2)                        ...A...................A...T..........C.............................G..T.......G...A..........................................................................A......        9      9 ,      9      9     134:>KF790279,A/Texas/82/2012(H3N2)                        
                   135 >KF790465,A/Iowa/01/2013(H3N2)                         .......................A...T..........C....T........................G..T.......G...A..........................................................................A......        9      9 ,      9      9     135:>KF790465,A/Iowa/01/2013(H3N2)                         
                   136 >KF790263,A/Oklahoma/05/2012(H3N2)                     .......................A...T..........C....T........................G..T.......G...A.................................................................................        8      8 ,      8      8     136:>KF790263,A/Oklahoma/05/2012(H3N2)                     
                   137 >KF789754,A/Kansas/14/2012(H3N2)                       .......................A...T..........C.............................G..T.......G...A...........................................................T.....................        8      8 ,      8      8     137:>KF789754,A/Kansas/14/2012(H3N2)                       
                   138 >KF789893,A/Massachusetts/15/2012(H3N2)                .......................A...T..........C.............................G..T.......G...A...............................R.................................................        8      8 ,      8      8     138:>KF789893,A/Massachusetts/15/2012(H3N2)                
                   139 >KF790080,A/Vermont/28/2012(H3N2)                      ..............Y........A...T..........C.............................G..T.......G...A.................................................................................        8      8 ,      8      8     139:>KF790080,A/Vermont/28/2012(H3N2)                      
                   140 >KF789572,A/Utah/02/2013(H3N2)                         .......................A...T..........C.............................G..T.......G...A..............................................................T..................        8      8 ,      8      8     140:>KF789572,A/Utah/02/2013(H3N2)                         
                   141 >KF789815,A/Washington/61/2012(H3N2)                   .......................A...T..........C........................A....G..T.......G...A.................................................................................        8      8 ,      8      8     141:>KF789815,A/Washington/61/2012(H3N2)                   
                   142 >KF789574,A/North Carolina/24/2012(H3N2)               .......................A...T..........C.............C...............G..T.......G...A.................................................................................        8      8 ,      8      8     142:>KF789574,A/North Carolina/24/2012(H3N2)               
                   143 >KF789594,A/Indiana/164/2012(H3N2)                     ............T..........A...T..........C.............C...............G..........G...A..............................................A................G.................       10     10 ,     10     10     143:>KF789594,A/Indiana/164/2012(H3N2)                     
                   144 >KF790260,A/Indiana/162/2012(H3N2)                     .......................A...T..........C.............C...............G..........G...A..............................................A................G.................        9      9 ,      9      9     144:>KF790260,A/Indiana/162/2012(H3N2)                     
                   145 >KF790111,A/Colorado/18/2012(H3N2)                     .......................A...T..........C.............C...............G..T.......G...A.............................A................A..................................       10     10 ,     10     10     145:>KF790111,A/Colorado/18/2012(H3N2)                     
                   146 >KF790200,A/Colorado/18/2012(H3N2)                     .......................A...T..........C.............C...............G..T.......G...A.............................A................A..................................       10     10 ,     10     10     146:>KF790200,A/Colorado/18/2012(H3N2)                     
                   147 >KF789653,A/Alabama/07/2013(H3N2)                      .......................A...T..........C.............C...............G..T.......G...A..................................A...........A..................................       10     10 ,     10     10     147:>KF789653,A/Alabama/07/2013(H3N2)                      
                   148 >KF789551,A/Nevada/04/2013(H3N2)                       .......................A...T..........C.............C...............G..T.......G...A.........................................A....A..................................       10     10 ,     10     10     148:>KF789551,A/Nevada/04/2013(H3N2)                       
                   149 >KF790395,A/Massachusetts/05/2013(H3N2)                .......................A...T..........C.............................G..T.......G...A..............................................A..................................        8      8 ,      8      8     149:>KF790395,A/Massachusetts/05/2013(H3N2)                
                   150 >KF790409,A/New York/06/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A........................A........................................................        8      8 ,      8      8     150:>KF790409,A/New York/06/2013(H3N2)                     
                   151 >KF789626,A/North Carolina/04/2013(H3N2)               .......................A...T.......A..C.............................G..T.......G...A........................A.......A................................................       10     10 ,     10     10     151:>KF789626,A/North Carolina/04/2013(H3N2)               
                   152 >KF789898,A/New Jersey/03/2013(H3N2)                   .........A.............A...T..........C.............................G..T.......G...A................................A................................................        9      9 ,      9      9     152:>KF789898,A/New Jersey/03/2013(H3N2)                   
                   153 >KF790017,A/Wisconsin/08/2013(H3N2)                    .........A.............A...T..........C.............................G..T.......G...A.................................................................................        8      8 ,      8      8     153:>KF790017,A/Wisconsin/08/2013(H3N2)                    
                   154 >KF790490,A/Oregon/11/2012(H3N2)                       .........T.............A...T..........C.............................G..T.......G...A.................................................................................        8      8 ,      8      8     154:>KF790490,A/Oregon/11/2012(H3N2)                       
                   155 >KF790281,A/New York/39/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     155:>KF790281,A/New York/39/2012(H3N2)                     
                   156 >KF790014,A/Oklahoma/08/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     156:>KF790014,A/Oklahoma/08/2013(H3N2)                     
                   157 >KF789985,A/Washington/50/2012(H3N2)                   .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     157:>KF789985,A/Washington/50/2012(H3N2)                   
                   158 >KF789948,A/Washington/07/2013(H3N2)                   .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     158:>KF789948,A/Washington/07/2013(H3N2)                   
                   159 >KF790326,A/District Of Columbia/02/2012(H3N2)         .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     159:>KF790326,A/District Of Columbia/02/2012(H3N2)         
                   160 >KF789887,A/Virginia/03/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     160:>KF789887,A/Virginia/03/2013(H3N2)                     
                   161 >KF790353,A/Indiana/01/2013(H3N2)                      .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     161:>KF790353,A/Indiana/01/2013(H3N2)                      
                   162 >KF790366,A/District Of Columbia/01/2013(H3N2)         .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     162:>KF790366,A/District Of Columbia/01/2013(H3N2)         
                   163 >KF790379,A/Minnesota/04/2013(H3N2)                    .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     163:>KF790379,A/Minnesota/04/2013(H3N2)                    
                   164 >KF789651,A/Alaska/06/2013(H3N2)                       .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     164:>KF789651,A/Alaska/06/2013(H3N2)                       
                   165 >KF790497,A/Minnesota/17/2012(H3N2)                    .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     165:>KF790497,A/Minnesota/17/2012(H3N2)                    
                   166 >KF790423,A/Arizona/11/2012(H3N2)                      .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     166:>KF790423,A/Arizona/11/2012(H3N2)                      
                   167 >KF789552,A/Colorado/02/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     167:>KF789552,A/Colorado/02/2013(H3N2)                     
                   168 >Index/32g12f1.c2,10-37                                .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     168:>Index/32g12f1.c2,10-37                                
                   169 >KF789548,A/Idaho/03/2013(H3N2)                        .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     169:>KF789548,A/Idaho/03/2013(H3N2)                        
                   170 >KF789576,A/Montana/13/2012(H3N2)                      .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     170:>KF789576,A/Montana/13/2012(H3N2)                      
                   171 >KF789598,A/New Jersey/04/2012(H3N2)                   .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     171:>KF789598,A/New Jersey/04/2012(H3N2)                   
                   172 >KF789631,A/Texas/09/2013(H3N2)                        .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     172:>KF789631,A/Texas/09/2013(H3N2)                        
                   173 >KF790385,A/Alaska/05/2013(H3N2)                       .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     173:>KF790385,A/Alaska/05/2013(H3N2)                       
                   174 >KF789738,A/Alaska/01/2013(H3N2)                       .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     174:>KF789738,A/Alaska/01/2013(H3N2)                       
                   175 >KF789831,A/New York/47/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     175:>KF789831,A/New York/47/2012(H3N2)                     
                   176 >KF790341,A/Utah/03/2013(H3N2)                         .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     176:>KF790341,A/Utah/03/2013(H3N2)                         
                   177 >KF790328,A/New Jersey/02/2013(H3N2)                   .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     177:>KF790328,A/New Jersey/02/2013(H3N2)                   
                   178 >KF789946,A/Delaware/24/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     178:>KF789946,A/Delaware/24/2012(H3N2)                     
                   179 >KF789961,A/Rhode Island/02/2013(H3N2)                 .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     179:>KF789961,A/Rhode Island/02/2013(H3N2)                 
                   180 >KF790008,A/Texas/81/2012(H3N2)                        .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     180:>KF790008,A/Texas/81/2012(H3N2)                        
                   181 >KF790221,A/Arizona/09/2012(H3N2)                      .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     181:>KF790221,A/Arizona/09/2012(H3N2)                      
                   182 >KF790043,A/Florida/09/2013(H3N2)                      .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     182:>KF790043,A/Florida/09/2013(H3N2)                      
                   183 >KF790273,A/California/42/2012(H3N2)                   .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     183:>KF790273,A/California/42/2012(H3N2)                   
                   184 >KF790124,A/California/04/2013(H3N2)                   .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     184:>KF790124,A/California/04/2013(H3N2)                   
                   185 >KF790247,A/New York/39/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     185:>KF790247,A/New York/39/2012(H3N2)                     
                   186 >KF790194,A/Florida/40/2012(H3N2)                      .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     186:>KF790194,A/Florida/40/2012(H3N2)                      
                   187 >KF790451,A/Oklahoma/05/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     187:>KF790451,A/Oklahoma/05/2013(H3N2)                     
                   188 >KF790168,A/New York/37/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     188:>KF790168,A/New York/37/2012(H3N2)                     
                   189 >KF790130,A/Colorado/27/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     189:>KF790130,A/Colorado/27/2012(H3N2)                     
                   190 >KF790267,A/Alabama/18/2012(H3N2)                      .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     190:>KF790267,A/Alabama/18/2012(H3N2)                      
                   191 >KF790079,A/Nebraska/02/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     191:>KF790079,A/Nebraska/02/2013(H3N2)                     
                   192 >KF790261,A/Rhode Island/08/2012(H3N2)                 .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     192:>KF790261,A/Rhode Island/08/2012(H3N2)                 
                   193 >KF790250,A/Indiana/161/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     193:>KF790250,A/Indiana/161/2012(H3N2)                     
                   194 >KF790186,A/Washington/52/2012(H3N2)                   .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     194:>KF790186,A/Washington/52/2012(H3N2)                   
                   195 >KF790215,A/Delaware/10/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     195:>KF790215,A/Delaware/10/2012(H3N2)                     
                   196 >KF790453,A/North Dakota/01/2013(H3N2)                 .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     196:>KF790453,A/North Dakota/01/2013(H3N2)                 
                   197 >KF790159,A/Virginia/06/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     197:>KF790159,A/Virginia/06/2013(H3N2)                     
                   198 >KF790082,A/Minnesota/01/2013(H3N2)                    .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     198:>KF790082,A/Minnesota/01/2013(H3N2)                    
                   199 >KF790074,A/Vermont/28/2012(H3N2)                      .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     199:>KF790074,A/Vermont/28/2012(H3N2)                      
                   200 >KF790291,A/Arizona/09/2012(H3N2)                      .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     200:>KF790291,A/Arizona/09/2012(H3N2)                      
                   201 >KF790018,A/New York/05/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     201:>KF790018,A/New York/05/2013(H3N2)                     
                   202 >KF789996,A/New York/35/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     202:>KF789996,A/New York/35/2012(H3N2)                     
                   203 >KF790309,A/Missouri/02/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     203:>KF790309,A/Missouri/02/2013(H3N2)                     
                   204 >KF790324,A/Maryland/01/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     204:>KF790324,A/Maryland/01/2013(H3N2)                     
                   205 >KF789917,A/North Carolina/01/2013(H3N2)               .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     205:>KF789917,A/North Carolina/01/2013(H3N2)               
                   206 >KF789859,A/Michigan/02/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     206:>KF789859,A/Michigan/02/2013(H3N2)                     
                   207 >KF789751,A/New Mexico/05/2013(H3N2)                   .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     207:>KF789751,A/New Mexico/05/2013(H3N2)                   
                   208 >KF789712,A/Texas/91/2012(H3N2)                        .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     208:>KF789712,A/Texas/91/2012(H3N2)                        
                   209 >KF789663,A/Alabama/17/2012(H3N2)                      .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     209:>KF789663,A/Alabama/17/2012(H3N2)                      
                   210 >KC892572,A/Pennsylvania/09/2012(H3N2)                 .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     210:>KC892572,A/Pennsylvania/09/2012(H3N2)                 
                   211 >KF790420,A/New Hampshire/03/2013(H3N2)                .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     211:>KF790420,A/New Hampshire/03/2013(H3N2)                
                   212 >KF789556,A/California/15/2013(H3N2)                   .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     212:>KF789556,A/California/15/2013(H3N2)                   
                   213 >KF789533,A/Washington/06/2013(H3N2)                   .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     213:>KF789533,A/Washington/06/2013(H3N2)                   
                   214 >KF790444,A/Delaware/15/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     214:>KF790444,A/Delaware/15/2012(H3N2)                     
                   215 >KF789557,A/Florida/06/2013(H3N2)                      .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     215:>KF789557,A/Florida/06/2013(H3N2)                      
                   216 >KF789583,A/Alabama/24/2012(H3N2)                      .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     216:>KF789583,A/Alabama/24/2012(H3N2)                      
                   217 >KF789629,A/California/16/2013(H3N2)                   .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     217:>KF789629,A/California/16/2013(H3N2)                   
                   218 >KF789698,A/Pennsylvania/09/2012(H3N2)                 .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     218:>KF789698,A/Pennsylvania/09/2012(H3N2)                 
                   219 >KF790375,A/Oklahoma/05/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     219:>KF790375,A/Oklahoma/05/2013(H3N2)                     
                   220 >KF789768,A/Oregon/12/2012(H3N2)                       .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     220:>KF789768,A/Oregon/12/2012(H3N2)                       
                   221 >KF789869,A/Hawaii/02/2013(H3N2)                       .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     221:>KF789869,A/Hawaii/02/2013(H3N2)                       
                   222 >KF789928,A/Maryland/30/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     222:>KF789928,A/Maryland/30/2012(H3N2)                     
                   223 >KF790320,A/Washington/04/2013(H3N2)                   .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     223:>KF790320,A/Washington/04/2013(H3N2)                   
                   224 >KF790113,A/Alabama/17/2012(H3N2)                      .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     224:>KF790113,A/Alabama/17/2012(H3N2)                      
                   225 >KF790003,A/Montana/10/2012(H3N2)                      .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     225:>KF790003,A/Montana/10/2012(H3N2)                      
                   226 >KF790022,A/North Dakota/02/2013(H3N2)                 .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     226:>KF790022,A/North Dakota/02/2013(H3N2)                 
                   227 >KF790061,A/Delaware/01/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A.................................................................................        7      7 ,      7      7     227:>KF790061,A/Delaware/01/2013(H3N2)                     
                   228 >KF790293,A/New Hampshire/12/2012(H3N2)                .......................A...T..........C.............................G..T.......G...A...C.............................................................................        8      8 ,      8      8     228:>KF790293,A/New Hampshire/12/2012(H3N2)                
                   229 >KF789995,A/Hawaii/26/2012(H3N2)                       .......................A...T..........C.............................G..T.......G...A...C.............................................................................        8      8 ,      8      8     229:>KF789995,A/Hawaii/26/2012(H3N2)                       
                   230 >KF790426,A/Pennsylvania/21/2012(H3N2)                 .......................A...T..........C.............................G..T.......G...A...C.............................................................................        8      8 ,      8      8     230:>KF790426,A/Pennsylvania/21/2012(H3N2)                 
                   231 >KF790436,A/Massachusetts/07/2012(H3N2)                .......................A...T..........C.............................G..T.......G...A...C.............................................................................        8      8 ,      8      8     231:>KF790436,A/Massachusetts/07/2012(H3N2)                
                   232 >KF790183,A/Hawaii/28/2012(H3N2)                       .......................A...T..........C.............................G..T.......G...A...C.............................................................................        8      8 ,      8      8     232:>KF790183,A/Hawaii/28/2012(H3N2)                       
                   233 >KF790006,A/Hawaii/25/2012(H3N2)                       .......................A...T..........C.............................G..T.......G...A...C.............................................................................        8      8 ,      8      8     233:>KF790006,A/Hawaii/25/2012(H3N2)                       
                   234 >KF790280,A/New York/38/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A...C.............................................................................        8      8 ,      8      8     234:>KF790280,A/New York/38/2012(H3N2)                     
                   235 >KF790240,A/Hawaii/29/2012(H3N2)                       .......................A...T..........C.............................G..T.......G...A...C.............................................................................        8      8 ,      8      8     235:>KF790240,A/Hawaii/29/2012(H3N2)                       
                   236 >KF789916,A/Hawaii/45/2012(H3N2)                       .......................A...T..........C.............................G..T.......G...A...C.............................................................................        8      8 ,      8      8     236:>KF789916,A/Hawaii/45/2012(H3N2)                       
                   237 >KF790219,A/New York/38/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A...C.............................................................................        8      8 ,      8      8     237:>KF790219,A/New York/38/2012(H3N2)                     
                   238 >KF789987,A/Hawaii/25/2012(H3N2)                       .......................A...T..........C.............................G..T.......G...A...C.............................................................................        8      8 ,      8      8     238:>KF789987,A/Hawaii/25/2012(H3N2)                       
                   239 >KF789997,A/Hawaii/26/2012(H3N2)                       .......................A...T..........C.............................G..T.......G...A...C.............................................................................        8      8 ,      8      8     239:>KF789997,A/Hawaii/26/2012(H3N2)                       
                   240 >KF790276,A/Hawaii/30/2012(H3N2)                       .......................A...T..........C.............................G..T.......G...A...C.............................................................................        8      8 ,      8      8     240:>KF790276,A/Hawaii/30/2012(H3N2)                       
                   241 >KF789933,A/California/49/2012(H3N2)                   .......................A...T.....T....C.............................G..T.......G...A...C.............................................................................        9      9 ,      9      9     241:>KF789933,A/California/49/2012(H3N2)                   
                   242 >KF789875,A/New Hampshire/11/2012(H3N2)                .......................A...T..........C.............................G..T.......G...A...C...............................................................G.............        9      9 ,      9      9     242:>KF789875,A/New Hampshire/11/2012(H3N2)                
                   243 >KF789659,A/New Hampshire/11/2012(H3N2)                .......................A...T..........C.............................G..T.......G...A...C...............................................................G.............        9      9 ,      9      9     243:>KF789659,A/New Hampshire/11/2012(H3N2)                
                   244 >KF790450,A/New Mexico/03/2013(H3N2)                   .......................A...T..........C.............................G..T.......G...A...CA............................................................................        9      9 ,      9      9     244:>KF790450,A/New Mexico/03/2013(H3N2)                   
                   245 >KF789900,A/Rhode Island/06/2013(H3N2)                 .............G.........A...T..........C.............................G..T.......G...A............................................C....................................        9      9 ,      9      9     245:>KF789900,A/Rhode Island/06/2013(H3N2)                 
                   246 >KF789558,A/Michigan/01/2013(H3N2)                     A......................A...T..........C............T................G..T.......G...A.................................................................................        9      9 ,      9      9     246:>KF789558,A/Michigan/01/2013(H3N2)                     
                   247 >KF790097,A/Wyoming/18/2012(H3N2)                      .......................A...T..........C.............................G..T.......G...A...........................C.......A.............................................        9      9 ,      9      9     247:>KF790097,A/Wyoming/18/2012(H3N2)                      
                   248 >KF789538,A/Pennsylvania/03/2013(H3N2)                 .......................A...T..........C.............................G..T.......G...AC................................................................................        8      8 ,      8      8     248:>KF789538,A/Pennsylvania/03/2013(H3N2)                 
                   249 >KF789834,A/Rhode Island/09/2012(H3N2)                 .......................A...T..........C.............................G..T.......G...AC................................................................................        8      8 ,      8      8     249:>KF789834,A/Rhode Island/09/2012(H3N2)                 
                   250 >KF789773,A/North Carolina/28/2012(H3N2)               .......................A...T..........C..................T..........G..T.......G...A.................................................................................        8      8 ,      8      8     250:>KF789773,A/North Carolina/28/2012(H3N2)               
                   251 >KF789735,A/Montana/03/2013(H3N2)                      .......................A...T..........C..................T..........G..T.......G...A.................................................................................        8      8 ,      8      8     251:>KF789735,A/Montana/03/2013(H3N2)                      
                   252 >KF789853,A/West Virginia/10/2013(H3N2)                .......................A...T..........C..................T..........G..T.......G...A..................................................C..............................        9      9 ,      9      9     252:>KF789853,A/West Virginia/10/2013(H3N2)                
                   253 >KF789856,A/West Virginia/05/2013(H3N2)                .......................A...T..........C..................T..........G..T.......G...A..................................................C..............................        9      9 ,      9      9     253:>KF789856,A/West Virginia/05/2013(H3N2)                
                   254 >KF789854,A/West Virginia/11/2013(H3N2)                .......................A...T..........C..................T..........G..T.......G...A..................................................C..............................        9      9 ,      9      9     254:>KF789854,A/West Virginia/11/2013(H3N2)                
                   255 >KF789851,A/West Virginia/06/2013(H3N2)                .......................A...T..........C..................T..........G..T.......G...A..................................................C..............................        9      9 ,      9      9     255:>KF789851,A/West Virginia/06/2013(H3N2)                
                   256 >KF789945,A/Texas/01/2013(H3N2)                        .......................A...T..........C.............................G..T.......G...A..........G......................................................................        8      8 ,      8      8     256:>KF789945,A/Texas/01/2013(H3N2)                        
                   257 >KF789703,A/Montana/14/2012(H3N2)                      .......................A...T..........C.............................G..T......AG...A.................................................................................        8      8 ,      8      8     257:>KF789703,A/Montana/14/2012(H3N2)                      
                   258 >KF790433,A/Delaware/11/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A.....................................................................A...........        8      8 ,      8      8     258:>KF790433,A/Delaware/11/2012(H3N2)                     
                   259 >KF790301,A/Delaware/07/2013(H3N2)                     .......................AA..T..........C.............................G..T.......G...A.................................................................................        8      8 ,      8      8     259:>KF790301,A/Delaware/07/2013(H3N2)                     
                   260 >KF790338,A/Kentucky/01/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A........................................................................G........        8      8 ,      8      8     260:>KF790338,A/Kentucky/01/2013(H3N2)                     
                   261 >KF790070,A/Oregon/15/2012(H3N2)                       .......................A...T..........C.......G.....................G..T.......G...A.................................................................................        8      8 ,      8      8     261:>KF790070,A/Oregon/15/2012(H3N2)                       
                   262 >KF789610,A/Wyoming/03/2013(H3N2)                      .......................A...T..........C.............................G..T.......G...A..............A..................................................................        8      8 ,      8      8     262:>KF789610,A/Wyoming/03/2013(H3N2)                      
                   263 >KF790340,A/California/18/2013(H3N2)                   ........G..............A...T..........C.............................G..T.......G...A.................................................................................        8      8 ,      8      8     263:>KF790340,A/California/18/2013(H3N2)                   
                   264 >KF789649,A/New Mexico/11/2013(H3N2)                   ...R...................A...T..........C.............................G..T.......G...A.................................................................................        8      8 ,      8      8     264:>KF789649,A/New Mexico/11/2013(H3N2)                   
                   265 >KF789717,A/Nevada/27/2012(H3N2)                       .......................A...T..........C.....A.......................G..T.......G...A................................................................................A        9      9 ,      9      9     265:>KF789717,A/Nevada/27/2012(H3N2)                       
                   266 >KF790315,A/Nevada/36/2012(H3N2)                       .......................A...T..........C.....A.......................G..T.......G...A................................................................................A        9      9 ,      9      9     266:>KF790315,A/Nevada/36/2012(H3N2)                       
                   267 >KF790506,A/Nevada/03/2013(H3N2)                       .......................A...T..........C.....A.......................G..T.......G...A................................................................................A        9      9 ,      9      9     267:>KF790506,A/Nevada/03/2013(H3N2)                       
                   268 >KF789824,A/Idaho/38/2012(H3N2)                        .......................A...T..........C.............................G..T.......G...A................................................................................A        8      8 ,      8      8     268:>KF789824,A/Idaho/38/2012(H3N2)                        
                   269 >KF790489,A/Utah/27/2012(H3N2)                         .......................A...T..........C.............................G..T.......G...A................................................................................A        8      8 ,      8      8     269:>KF790489,A/Utah/27/2012(H3N2)                         
                   270 >KF790505,A/Washington/53/2012(H3N2)                   .......................A...T..........C.............................G..T.......G...A................................................................................A        8      8 ,      8      8     270:>KF790505,A/Washington/53/2012(H3N2)                   
                   271 >KF789959,A/Montana/01/2013(H3N2)                      .......................A...T..........C.............................G..T.......G...A................................................................................A        8      8 ,      8      8     271:>KF789959,A/Montana/01/2013(H3N2)                      
                   272 >KF790102,A/Idaho/23/2012(H3N2)                        .......................A...T..........C.............................G..T.......G...A................................................................................A        8      8 ,      8      8     272:>KF790102,A/Idaho/23/2012(H3N2)                        
                   273 >KF789798,A/Idaho/37/2012(H3N2)                        .......................A...T..........C.............................G..T.......G...A................................................................................A        8      8 ,      8      8     273:>KF789798,A/Idaho/37/2012(H3N2)                        
                   274 >KF790515,A/Idaho/24/2012(H3N2)                        .......................A...T..........C.............................G..T.......G...A................................................................................A        8      8 ,      8      8     274:>KF790515,A/Idaho/24/2012(H3N2)                        
                   275 >KF789929,A/Maryland/29/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A............A.....................A.............................G................       10     10 ,     10     10     275:>KF789929,A/Maryland/29/2012(H3N2)                     
                   276 >KF790026,A/New Mexico/08/2013(H3N2)                   .......................A...T..........C.............................G..T.......G...A................................................................G................        8      8 ,      8      8     276:>KF790026,A/New Mexico/08/2013(H3N2)                   
                   277 >KF789608,A/Oklahoma/06/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A................................................................G................        8      8 ,      8      8     277:>KF789608,A/Oklahoma/06/2013(H3N2)                     
                   278 >KF789564,A/Florida/12/2013(H3N2)                      .......................A...T..........C.............................G..T.......G...A.........G.......................................................................        8      8 ,      8      8     278:>KF789564,A/Florida/12/2013(H3N2)                      
                   279 >KF790332,A/Massachusetts/04/2013(H3N2)                .......................A...T..........C.............................G..T...........A.................................................................................        6      6 ,      6      6     279:>KF790332,A/Massachusetts/04/2013(H3N2)                
                   280 >KF789786,A/Washington/60/2012(H3N2)                   .......................A...T..........C.............................G..T.......G...A.......................T.........................................................        8      8 ,      8      8     280:>KF789786,A/Washington/60/2012(H3N2)                   
                   281 >KC892272,A/Alaska/04/2012(H3N2)                       ..G....................A...T....C.....C.............................G..T.......G...A.................................................................................        9      9 ,      9      9     281:>KC892272,A/Alaska/04/2012(H3N2)                       
                   282 >KF790090,A/Alaska/04/2012(H3N2)                       ..G....................A...T....C.....C.............................G..T.......G...A.................................................................................        9      9 ,      9      9     282:>KF790090,A/Alaska/04/2012(H3N2)                       
                   283 >KF790386,A/Maryland/05/2013(H3N2)                     .......................A...T..........C.............................G..T.A.....G...A.........................................................G.......................        9      9 ,      9      9     283:>KF790386,A/Maryland/05/2013(H3N2)                     
                   284 >KF789700,A/Maine/05/2012(H3N2)                        .......................A...T..........C.............................G..T.......G.......................C.............................................................        7      7 ,      7      7     284:>KF789700,A/Maine/05/2012(H3N2)                        
                   285 >KC892737,A/Maine/05/2012(H3N2)                        .......................A...T..........C.............................G..T.......G.......................C.............................................................        7      7 ,      7      7     285:>KC892737,A/Maine/05/2012(H3N2)                        
                   286 >KF789578,A/New Hampshire/16/2012(H3N2)                .......................A...T..........C............................AG..T.......G.G.R.................................................................................        9      9 ,      9      9     286:>KF789578,A/New Hampshire/16/2012(H3N2)                
                   287 >KF789652,A/Delaware/06/2013(H3N2)                     ......G................A...T..........C..A..........................G..T.......G...A.................................................................................        9      9 ,      9      9     287:>KF789652,A/Delaware/06/2013(H3N2)                     
                   288 >KF790528,A/Maryland/33/2012(H3N2)                     .......................A...T..........C.T...........................G..T.......G...A....................................T............................................        9      9 ,      9      9     288:>KF790528,A/Maryland/33/2012(H3N2)                     
                   289 >KF790117,A/Louisiana/04/2013(H3N2)                    ...............G.......A...T..........C...................A.........G..T.......G...A.................................................................................        9      9 ,      9      9     289:>KF790117,A/Louisiana/04/2013(H3N2)                    
                   290 >KF790415,A/Delaware/08/2013(H3N2)                     .......................A...T..........C.....................C....C..G..T.......G...A.................................................................................        9      9 ,      9      9     290:>KF790415,A/Delaware/08/2013(H3N2)                     
                   291 >A/Czech Republic/121/2012,2012/03/06,Czech Republic   .......................A...T..........CC.........A..................G..T.......G...A....................................................................G............       10     10 ,     10     10     291:>A/Czech Republic/121/2012,2012/03/06,Czech Republic   
                   292 >KF790038,A/Massachusetts/07/2013(H3N2)                .Y.....................A...T..........C.............................G..T.......G...A....................................................................R............        9      9 ,      9      9     292:>KF790038,A/Massachusetts/07/2013(H3N2)                
                   293 >KF789905,A/New Jersey/05/2013(H3N2)                   .......................A...T..........C......R..A...................G..T.......G...A.................................................................................        9      9 ,      9      9     293:>KF789905,A/New Jersey/05/2013(H3N2)                   
                   294 >KF790156,A/North Carolina/02/2013(H3N2)               .......................A...T..........C.............................G..T.......G...A..................A..................................C...........................        9      9 ,      9      9     294:>KF790156,A/North Carolina/02/2013(H3N2)               
                   295 >KF790152,A/Oklahoma/03/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A..................A..................................C...........................        9      9 ,      9      9     295:>KF790152,A/Oklahoma/03/2013(H3N2)                     
                   296 >KF790056,A/North Carolina/06/2013(H3N2)               .......................A...T..G.......C....................R........G..T.......G...A.................................................................................        9      9 ,      9      9     296:>KF790056,A/North Carolina/06/2013(H3N2)               
                   297 >KF790062,A/Texas/111/2012(H3N2)                       .......................A...T........C.C.............................G..T.......G...A.......................................................................G.........        9      9 ,      9      9     297:>KF790062,A/Texas/111/2012(H3N2)                       
                   298 >KF790319,A/Utah/07/2013(H3N2)                         ..........GA...........A...T..........C.............................GA.T.......G...A.................................................................................       10     10 ,     10     10     298:>KF790319,A/Utah/07/2013(H3N2)                         
                   299 >KF790365,A/Texas/11/2013(H3N2)                        .......................A...T..........C.............................GA.T.......G...A.................................................................................        8      8 ,      8      8     299:>KF790365,A/Texas/11/2013(H3N2)                        
                   300 >KF789926,A/Hawaii/24/2012(H3N2)                       .......................A...T..........C.............................GA.T.......G...A.................................................................................        8      8 ,      8      8     300:>KF789926,A/Hawaii/24/2012(H3N2)                       
                   301 >KF790107,A/Kentucky/16/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A.............................................................T...................        8      8 ,      8      8     301:>KF790107,A/Kentucky/16/2012(H3N2)                     
                   302 >KF790015,A/Florida/08/2013(H3N2)                      .......................A...T..........C.............................G..T.......G...A......................................A..........................................        8      8 ,      8      8     302:>KF790015,A/Florida/08/2013(H3N2)                      
                   303 >KF790412,A/New York/60/2012(H3N2)                     .......................A...T..........C.............................G..T.......G...A................................................A................................        8      8 ,      8      8     303:>KF790412,A/New York/60/2012(H3N2)                     
                   304 >KF789616,A/Maryland/03/2013(H3N2)                     .......................A...T..........C.............................G..T..T....G...A.................................................................................        8      8 ,      8      8     304:>KF789616,A/Maryland/03/2013(H3N2)                     
                   305 >KF789611,A/Kentucky/03/2013(H3N2)                     .......................A...T..........C...............T.............G..T.......G...A.................................................................................        8      8 ,      8      8     305:>KF789611,A/Kentucky/03/2013(H3N2)                     
                   306 >KF789825,A/Connecticut/13/2012(H3N2)                  .......................A...T..........C...............T.............G..T.......G...A................................A................................................        9      9 ,      9      9     306:>KF789825,A/Connecticut/13/2012(H3N2)                  
                   307 >KF790116,A/Alaska/03/2013(H3N2)                       .......................A...T..........C.............................G..T.......G...A................................A....T...........................................        9      9 ,      9      9     307:>KF790116,A/Alaska/03/2013(H3N2)                       
                   308 >KF789839,A/Wisconsin/06/2013(H3N2)                    .................T.....A...T..........C.............................G..T.......G...A................................A................................................        9      9 ,      9      9     308:>KF789839,A/Wisconsin/06/2013(H3N2)                    
                   309 >KF790388,A/Maryland/06/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A................T...............A................................................        9      9 ,      9      9     309:>KF790388,A/Maryland/06/2013(H3N2)                     
                   310 >KF790352,A/New Mexico/24/2012(H3N2)                   .......................A...T..........C.............................G..T.......G...A................................A................................................        8      8 ,      8      8     310:>KF790352,A/New Mexico/24/2012(H3N2)                   
                   311 >KF789543,A/Massachusetts/06/2013(H3N2)                .......................A...T..........C.............................G..T.......G...A................................A................................................        8      8 ,      8      8     311:>KF789543,A/Massachusetts/06/2013(H3N2)                
                   312 >KF789883,A/Kansas/16/2012(H3N2)                       .......................A...T..........C......................A......G..T.......G...A................................A................................................        9      9 ,      9      9     312:>KF789883,A/Kansas/16/2012(H3N2)                       
                   313 >KF789909,A/Wyoming/01/2013(H3N2)                      .......................A...T..........C......................A......G..T.......G...A................................A................................................        9      9 ,      9      9     313:>KF789909,A/Wyoming/01/2013(H3N2)                      
                   314 >KF789981,A/West Virginia/01/2013(H3N2)                .......................A...T..........C.............................G..T.......G...A................................R.........................Y......................        9      9 ,      9      9     314:>KF789981,A/West Virginia/01/2013(H3N2)                
                   315 >KF790480,A/Massachusetts/11/2013(H3N2)                .......................A...T..........C.............................G..T.......G...A..........................................................A......................        8      8 ,      8      8     315:>KF790480,A/Massachusetts/11/2013(H3N2)                
                   316 >KF789743,A/New Mexico/06/2013(H3N2)                   .....................G.A...T..........C.............................G..T.......G...A.................................................................................        8      8 ,      8      8     316:>KF789743,A/New Mexico/06/2013(H3N2)                   
                   317 >KF789691,A/New York/04/2013(H3N2)                     .......................A...T..........C.............................G..T.......G...A.A...............................................................................        8      8 ,      8      8     317:>KF789691,A/New York/04/2013(H3N2)                     
                   318 >KF790364,A/Iowa/02/2013(H3N2)                         .......................A...T..........C.............................G..T.......G...A.A...............................................................................        8      8 ,      8      8     318:>KF790364,A/Iowa/02/2013(H3N2)                         
                   319 >KF789683,A/New Jersey/08/2012(H3N2)                   .......................A...T..........C.............................G..T.......G...A.A...............................................................................        8      8 ,      8      8     319:>KF789683,A/New Jersey/08/2012(H3N2)                   
                   320 >KF790234,A/Pennsylvania/20/2012(H3N2)                 .......................A...T..........C.............................G..T.......G...A.A...............................................................................        8      8 ,      8      8     320:>KF790234,A/Pennsylvania/20/2012(H3N2)                 
                   321 >KF789865,A/Arkansas/07/2013(H3N2)                     .......................A...T..........C........A....................G..T.......G...A.A...............................................................................        9      9 ,      9      9     321:>KF789865,A/Arkansas/07/2013(H3N2)                     
                   322 >KF790095,A/Arkansas/06/2013(H3N2)                     .......................A...T..........C........A....................G..T.......G...A.A...............................................................................        9      9 ,      9      9     322:>KF790095,A/Arkansas/06/2013(H3N2)                     
                   323 >KF789867,A/Arkansas/04/2013(H3N2)                     .......................A...T..........C........A....................G..T.......G...A.A...............................................................................        9      9 ,      9      9     323:>KF789867,A/Arkansas/04/2013(H3N2)                     
                   324 >KF790145,A/Arkansas/13/2013(H3N2)                     .......................A...T..........C........A....................G..T.......G...A.A...............................................................................        9      9 ,      9      9     324:>KF790145,A/Arkansas/13/2013(H3N2)                     
                   325 >KF789868,A/Arkansas/03/2013(H3N2)                     .......................A...T..........C........A....................G..T.......G...A.A...............................................................................        9      9 ,      9      9     325:>KF789868,A/Arkansas/03/2013(H3N2)                     
                   326 >KF790181,A/Alaska/23/2012(H3N2)                       .......................A..............C........C..............A.....G..........G...A.................................................................................        7      7 ,      7      7     326:>KF790181,A/Alaska/23/2012(H3N2)                       
                   327 >KF789800,A/Alaska/31/2012(H3N2)                       .......................A..............C........C..............A.....G..........G...A.................................................................................        7      7 ,      7      7     327:>KF789800,A/Alaska/31/2012(H3N2)                       
                   328 >KF789581,A/North Dakota/07/2012(H3N2)                 .......................A..............C........C..............A.....G..........G...A...............................A.................................................        8      8 ,      8      8     328:>KF789581,A/North Dakota/07/2012(H3N2)                 
                   329 >KF789880,A/Arkansas/05/2012(H3N2)                     .......................A..............C........C..............A...T............G...A..............A..................A...............................................        9      9 ,      9      9     329:>KF789880,A/Arkansas/05/2012(H3N2)                     
                   330 >KF790089,A/Hawaii/27/2012(H3N2)                       .......................A..............C........C..............A.....G..........G...A..........................C......................................................        8      8 ,      8      8     330:>KF790089,A/Hawaii/27/2012(H3N2)                       
                   331 >KF790091,A/Hawaii/27/2012(H3N2)                       .......................A..............C........C..............A.....G..........G...A..........................C......................................................        8      8 ,      8      8     331:>KF790091,A/Hawaii/27/2012(H3N2)                       
                   332 >KF790231,A/Alaska/24/2012(H3N2)                       .......................A..............C........C..............A.G...G..........G...A.................................................................................        8      8 ,      8      8     332:>KF790231,A/Alaska/24/2012(H3N2)                       
                   333 >KF790369,A/Alaska/24/2012(H3N2)                       .......................A..............C........C..............A.G...G..........G...A.................................................................................        8      8 ,      8      8     333:>KF790369,A/Alaska/24/2012(H3N2)                       
                   334 >KF790203,A/Alaska/22/2012(H3N2)                       .......................A..............C........C.....A........A.....G..........G...A.................................................................................        8      8 ,      8      8     334:>KF790203,A/Alaska/22/2012(H3N2)                       
                   335 >KF790165,A/Alaska/22/2012(H3N2)                       .......................A..............C........C.....A........A.....G..........G...A.................................................................................        8      8 ,      8      8     335:>KF790165,A/Alaska/22/2012(H3N2)                       
                   336 >KF790204,A/Alaska/23/2012(H3N2)                       .......................A..............C........C..............A.....G..........G...A.................................................................................        7      7 ,      7      7     336:>KF790204,A/Alaska/23/2012(H3N2)                       
                   337 >KF790143,A/Texas/14/2013(H3N2)                        .....G..................A.............C.............................G..........G...A.........G...............................T....A...........G......................       10     10 ,     10     10     337:>KF790143,A/Texas/14/2013(H3N2)                        
                   338 >KF789852,A/Massachusetts/12/2013(H3N2)                .....G..................A.............C.............................G..........G...A........GG..............................AT....A...........G......................       12     12 ,     12     12     338:>KF789852,A/Massachusetts/12/2013(H3N2)                
                   339 >KF790298,A/Massachusetts/13/2013(H3N2)                .....G.....A............A.............C.............................G..........G...A.........G...............................T....A...........G......................       11     11 ,     11     11     339:>KF790298,A/Massachusetts/13/2013(H3N2)                
                   340 >KF790355,A/Missouri/05/2013(H3N2)                     .....G..................A.............C.............................G..........G...A...C.....G...............................T....A..................................       10     10 ,     10     10     340:>KF790355,A/Missouri/05/2013(H3N2)                     
                   341 >KF789862,A/Florida/21/2013(H3N2)                      .....G..................A.............C.............................G..........G...A...C.....G...............................T....A..................................       10     10 ,     10     10     341:>KF789862,A/Florida/21/2013(H3N2)                      
                   342 >KF790400,A/New York/61/2012(H3N2)                     .........A............................C.......G.....................G..........G...A.................................................................................        6      6 ,      6      6     342:>KF790400,A/New York/61/2012(H3N2)                     
                                                                                                                                                                                                                                                    
                  ---Index----------------------------------------------------CTAGTAAGACTGCACAAACCTATGGTTGGCACTCTGTATTCTACGGATGGGCTGCATCCATGGTATGGAGGCCGCGTAGAGATGTGTTGCTATAAGGGGGCGGTTGGAGGTTCGTGGGGGCCGTGCGATAGCGTTCGTATGACCACCAACCAAGAAAAGGCCCTG 
                  -codon-position---------------------------------------------  11          2   12 1   2                21       1   1   2                 1  1 12   1           1     1 2 1  1      21 11211 121111112  1 121 12 11  11 11 1212121 
                                                                              000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 
                                                                              000000000001111111111111111112222222222222222333333333333333344444444444444444444555555555555555566666666666666667777777777777777777888888888888888888888899999999999 
                                                                              334444568990012455666778888890144455666779999000112233555899900112234556777888899012224444556789900000112233457781223455666667788899022334444445556677888911234555677 
                                                                              690358197392812409378570356957606958147361357369254803124108928140681698147037926141580136254321403469281502222851035468023675801203839890346780593714256829530026749
                  Attached Files
                  I'm interested in expert panflu damage estimates
                  my current links: [url]http://bit.ly/hFI7H[/url] ILI-charts: [url]http://bit.ly/CcRgT[/url]

                  Comment


                  • #24
                    Re: H3n2

                    Are the Indian mutations cause for concern?

                    Do the US sequences share the mutations that the Indian sequences have?
                    The salvage of human life ought to be placed above barter and exchange ~ Louis Harris, 1918

                    Comment


                    • #25
                      Re: H3n2

                      cause for concern ? I don't know. You'd have to compare it with the epidemiology in India
                      in May-July. Checking reassortments could be more important, here we only have segments 4,6,7
                      so far I checked 4,6 but I separated the genomes because that was easier.

                      I'm just tracking these to see from where to where it goes.
                      The American sequences are from winter 2012/2013 , the India sequences are from mid 2013
                      we'll have to wait for 2013/4 sequences to see whether the India mutations come to
                      Europe or even USA. USA had H3 last season, they may get mainly H1 this coming season
                      and some B later in March.
                      USA is doing this worldwide airplane collecting, "AF" (airforce) - sequences , HA only.
                      So maybe we'll know soon about the India mutations.



                      percent B since 1957 was:
                      50s:00,75,03,
                      60s:31,95,00,05,30,60,50,05,15,10
                      70s:05,01,04,76,00,02,70,01,03,98
                      80s:00,74,11,45,03,76,01,17,43,00
                      90s:86,01,71,01,26,15,22,01,23,01
                      00s:47,14,44,01,25,19,21,29,38,00
                      10s:26,18,22

                      -----------------------------------------------------------
                      India had : T144A,R158G,(L173S),V363K


                      amino-acid mutations in H3N2-HA since 1968:

                      Code:
                                                                           0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000
                                                                           0000000000000000000000000011111111111111111111111111111111122222222222222222222222222222222222333333333334444444555555
                                                                           0011111122244466667777999900112233344445555556667777777888800000011111122223344444566677789999001224679990066669000245
                                                                           7914568924617914690389148948072337802791346890121234569078924568923458934898912356802467891246185387371340216895369267
                                                                           ----------------------------------------------------------------------------------------------------------------------
                                                                           LYFALGDLNNTLDQSTKNNRIDHVETVKFDASTITGTTNGNAKGPGSGTKSGSTVLNDNSNQETSVQASVTRRTIWVGLSRIVVNNMRTPDTIENKKKNLITDINVENKRREDVDEVR
                      >1968//,182,CHN,A/Beijing/1/68                       ......................................................................................................................
                      >1972//,1643,RUS,A/Udorn/307/72                      ...V...F....N..........G..........S..........D..Y...........D..........K..........I.......G....................G.....K
                      >1979//,4199,THA,A/Bangkok/01/79                     ...VFAN.....N...RDS.KN.G.K........N.N.S.Y...SDNSYE.E.K...G..DK..K.R....K........G.IL..I...G.S......IV..........G.....K
                      >1983//,5660,HKG,A/HK/14/83                          ...VFAK.....N...RDS.KN.G.K........N.N.S.Y...SVNSYE.E.K...GKIDK..N.R....K..V.......IL.TI...G.S....R.IV....L....KG.....K
                      >1989//,7852,CHN,A/Beijing/353/89                    ..LVFAK.....N...RDS.KN.GKE..Y.....NDNASEY...SVKSHE.EYKA..GK.DR..N.R....K..V.......IL.TI...G.S...RR.IV....L....KG.....K
                      >1997/11/29,10924,USA,A/NY/503/97                    ..SVFAK.....N...RDS.EN.GKE..Y....NNSNA.TY..RSIKSHQLKYKA...K.DSD..A.....K..V...V...IL.TI.S.GKN.D.RR.IV.N..L..R.KG.....K
                      >2003/04/23,12897,USA,A/NY/214/03                    ..LVFAK....IN...GDSQENQGKK..Y....NNSN..TS..RSNKS.HLKYKA..EKGDSDI.A...I.K..VR.DV...IL.TI.S.GKN...RR.IV.N..LG.RKKG....AK
                      >A/Wisconsin/67/2005/08/                             ..LVFAK....IN...GDSQENQGKK..Y....NDSN..TSS.RSNNS.QLKFKA..EKVDNDIFA...I.K..VRINIP..IL.TI.S.GKN...RR.IVIN..LG.RKKG....AK
                      >2007/02/06,14278,AUS,A/Brisbane/10/07               ..LVFTK....IN...EDSQENQGKK..Y....NNSN..TS.IRSNNS.HLKFKA..EKGDNDIFA...I.K..VR.NIP..IL.TI.S.GKN...RR.IVI...LG..KKG....AK
                      >Index/Brisbane-like/2007                            ..LVFAK....IN...EDSQENQGKK..Y....NNSN..TS.IRSNNS.HLKFKA..EKGDNDVFA...I.K..VR.NIP..IL.TI.S.GKN...RR.IVI...LG..KKG....AK
                      >Index/Perth-like/2009                               ..LVFAK....IN...EDSQKNQGKK..Y....NNSN..TS.IRSKNS.HLNFKA..EQGDKDIFA...I.K..VR.NIP..IL.TI.S.GKN...RR.IVR...LG..KKG....AK
                      >Index/2009/Egypt/Iowa                               ..LVFAK....IN...EDSQENQGKK..Y....NNSN..TS.IRSNNS.HLNFKA..EQGDKDIFA...I.K.AVR.NIP..IL.TI.S.GKN...RR.IVR...LG..KKG....AK
                      >Index/USA-2007                                      ..LVFAK....IN...EDSQENQGKK..Y....NNSN..TS.IRSNNS.HLKFKA..EKGDNDIFA...I.K..VR.NIP..IL.TI.S.GKN...RR.IVI...LG..KKG....AK
                      >A/swine/Ontario/33853/2005(H3N2)                    FCLIFAK.S.M.....R.SQKN.DKE.TYY...TQSNADSY.RESVNSHNLDYKA...KGDRD.N......K..V...V.I.IL.TIQS.GNN...RR.IV.N.T.K.R.KG...Q.K
                      >A/Sw/Index/triple-reassortant/1998(H3N2)            ..LVFAK.....N...RDS.KN.GKEI.Y.S..TNDNAD.YS.ESVKSH.LEYKA...K.DS......I..KS.V...I...ILSTI.N..NY...R.KIV..V.L....KG.....K
                      >A/Index/1968(H3N2)                                  ......................................................................................................................
                      >A/Index_Fujian/2002(H3N2)                           ..LVFAK....IN...GDSQENQGKK..Y....NNSN..TS..RSNKS.QLKYKA..EKGDSDI.A...I.K..VR.DV...IL.TI.S.GKN...RR.IV.N..LG.RKKG....AK
                      >A/Index_Fujian/USA/2003(H3N2)                       ..LVFAK....IN...GDSQENQGKK..Y....NNSN..TS..RSNKS.HLKYKA..EKGDSDI.A...I.K..VR.DV...IL.TI.S.GKN...RR.IV.N..LG.RKK.....AK
                      >A/Index_Fujian_reass./2003/06(H3N2)                 ..LVFAK....IN...GDSQENQGKK..Y....NNSD..TS..RSNKS.HLKYKA..EKGDSDI.A...I.K..VR.DV...IL.TI.S.GKN...RR.IV.N..LG.RKKG....AK
                      >A/Index/32v/2011(H3N2)                              FCLIFAK.S.M.....R.SQKN.DKE.TYY.TNTQSNADSY.R.SVNSYNLNYKEQ..KGDKD.N.....IK..V...V.I.IL.TIQSH.EN....R.IV.N.T.KSR..G.INQ.K
                      >Index/H3N3-2011-reassortedEI/2011(H3N2)             ..LVFAK....IN...E.SQENQGKK..H....NNSN..TS.IRSNNS.HLNFKA..EQGDKDIFA...I.K.AVR.NIP.VIL.TI.S.GKNA..RR.IVR...LG..KKG....AK
                      >Index/H3N2-2011-normalEI/2011(H3N2)                 ..LVFAK....IN..AEDSHENQGKK.RY....NNSN..TS.IRSNNS.HLNFKA..EQGDKDIFA...I.K.AVR.NIP..IL.TI.S.GKN...RRSIMR...LG..KKG....AK
                      >Index/2009/Egypt-Iowa+NA,2009//                     ..LVFAK....IN...EDSQENQGKK..Y....NNSN..TS.IRSNNS.HLNFKA..EQGDKDIFA...I.K.AVR.NIP..IL.TI.S.GKN...RR.IVR...LG..KKG....AK
                      >A/Czech Republic/121/2012,2012/03/06,Czech Republic ..LVFAK....INRNI.DSQENQGKK..Y....NNNN..TS.IRSNNS.HLNFKA.DEQGDKDIFA.S.I.K.AVRINIP..IL.TI.S.GKK...RRSIVR...LG..KKG....AK
                      >Index/32g12f1.c2,10-37                              ..LVFAK....INRNIEDSQENQGKK..Y....NNSN..TS.IRSN.S.HLNFKA..EQGDKDIFA.S.I.K.AVRINIP..IL.TI.S.GKK...RRSIVR...LG..KKG....AK
                      >Index/32g12f1.c2,38-41                              ..LVFAK....INRNIEDSQENQGKK..Y....NNNN..TS.IRSN.S.HLNFKA..EQGDKDIFA.S.I.K.AVRINIP..IL.TI.S.GKK..RRRSIVR...LG..KKG....AK
                      >Index/32g12f1.c2,42-53                              ..LVFAK....IN...EDSQENQGKK..Y....NNSN..TS.IRSD.S.HLNFKA..EQGDKDIFA...I.K.SVRINIP..IL.TIQS.GKN...RR.IVR...LG..KKGN...AK
                      >Index/32g12f1.c2,55-62                              ..LVFAE..D.INR..E.SQENQGKK..H....NNSN..TS.IRSNNS.HLNFKA..EQGDKDIFA...I.K..VR.NIP.VIL.TI.S.GKNA..RR.IVR...LG..KKG....AK
                                                                           0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000
                                                                           0000000000000000000000000011111111111111111111111111111111122222222222222222222222222222222222333333333334444444555555
                                                                           0011111122244466667777999900112233344445555556667777777888800000011111122223344444566677789999001224679990066669000245
                                                                           7914568924617914690389148948072337802791346890121234569078924568923458934898912356802467891246185387371340216895369267
                                                                           ----------------------------------------------------------------------------------------------------------------------
                                                                           LYFALGDLNNTLDQSTKNNRIDHVETVKFDASTITGTTNGNAKGPGSGTKSGSTVLNDNSNQETSVQASVTRRTIWVGLSRIVVNNMRTPDTIENKKKNLITDINVENKRREDVDEVR



                      antigenic sites:
                      Cb 78-83 = 92-97 = SWSYIV
                      Sa 128-129 = 142-143
                      156-160 = 157-159 or 171-173 = KKGNS > 511-513 aaa 514-516 gga 517-519 aat
                      162-167= 176-181
                      Sb 187-198=
                      Ca1 169-173= 206-208= 238-240=
                      Ca2 140-145= 224-226=

                      India had : T144A,R158G,(L173S),V363K

                      so R158G and L173S mutated back to what we had before ~1990
                      T144A is new
                      (I'm not sure about the numbering - since this is H3, others should have the same numbers ?!)




                      human H3N2-HA that we have so far since May,2013 :

                      Code:
                                                                                   00000000000000
                                                                                   00011111222335
                                                                                   46645667139260
                                                                                   91448123494835
                                                                                   --------------
                                                                                   QSTTRNSLAVNNVD
                      >Index/2009/Egypt/Iowa                                       ..............
                      >AGY41834,A/India/LKO3818/2013,2013/06/25,India,H3N2,Human,4 ---AGS..SIKS--
                      >AGY41835,A/India/LKO3824/2013,2013/06/26,India,H3N2,Human,4 ---AGS.SSIKS--
                      >AGY41836,A/India/LKO3825/2013,2013/06/26,India,H3N2,Human,4 ---AGS.SSIKS--
                      >AGY41837,A/India/LKO3839/2013,2013/06/29,India,H3N2,Human,4 ---AGS.SSIKS--
                      >AGY41838,A/India/LKO3863/2013,2013/07/06,India,H3N2,Human,4 ----GS..SIKS--
                      >AGY41839,A/India/LKO3876/2013,2013/07/09,India,H3N2,Human,4 ---AGSGSSIKS--
                      >AGY41840,A/India/LKO3887/2013,2013/07/10,India,H3N2,Human,4 ----GS..SIKSK-
                      >AGY41841,A/India/LKO3889/2013,2013/07/11,India,H3N2,Human,4 ---AGS.SSIKS--
                      >AGY41842,A/India/LKO3893/2013,2013/07/12,India,H3N2,Human,4 ---AGS..SIKS--
                      >AGY41843,A/India/LKO3906/2013,2013/07/15,India,H3N2,Human,4 ----GS.SSIKSK-
                      >AGY41844,A/India/LKO3913/2013,2013/07/16,India,H3N2,Human,4 ---AGS..SIKSK-
                      >AGY41845,A/India/LKO3914/2013,2013/07/16,India,H3N2,Human,4 ---AGS..SIKSK-
                      >AGU01874,A/Taiwan/80710/2013,2013/05/10,Taiwan,H3N2,Human,4 RNI..S..SIKS.N
                      >AGU01876,A/Taiwan/80720/2013,2013/05/13,Taiwan,H3N2,Human,4 RNI..S..SIKS.N
                      >AGU01875,A/Taiwan/80723/2013,2013/05/14,Taiwan,H3N2,Human,4 RNI..S.SSIKS.N
                                                                                   00000000000000
                                                                                   00011111222335
                                                                                   46645667139260
                                                                                   91448123494835
                                                                                   --------------
                                                                                   QSTTRNSLAVNNVD
                      (plus the semi-secret = "publicly-available" sequences at GISAID)
                      Attached Files
                      I'm interested in expert panflu damage estimates
                      my current links: [url]http://bit.ly/hFI7H[/url] ILI-charts: [url]http://bit.ly/CcRgT[/url]

                      Comment


                      • #26
                        Re: H3n2

                        new H3N2 genomes from 2012/3=2012f at genbank
                        i.e. from Boston, Santa Clara

                        391 genomes now

                        some of the Helsinki sequences were removed, see here:
                        http://www.flutrackers.com/forum/sho...d.php?t=218064



                        here the codes for those who google for it
                        (google last cached this thread on 2014/03/31 )

                        Code:
                        AB796432
                        AB796433
                        CY130183
                        CY130191
                        CY130192
                        CY130193
                        CY130194
                        CY130195
                        CY130196
                        CY130197
                        CY130198
                        CY130199
                        CY130200
                        CY131965
                        CY131966
                        CY131967
                        CY134459
                        CY134460
                        CY134461
                        CY134462
                        CY134463
                        CY134464
                        CY134635
                        CY134636
                        CY134637
                        CY134638
                        CY134639
                        CY134640
                        CY134641
                        CY134642
                        CY134643
                        CY134644
                        CY134645
                        CY134646
                        CY134647
                        CY134648
                        CY134649
                        CY134650
                        CY134651
                        CY134652
                        CY134653
                        CY134654
                        CY134655
                        CY134656
                        CY134657
                        CY134658
                        CY134659
                        CY134660
                        CY134661
                        CY134662
                        CY134663
                        CY134664
                        CY134665
                        CY134666
                        CY134667
                        CY134668
                        CY134669
                        CY134670
                        CY134671
                        CY134672
                        CY134673
                        CY134674
                        CY134675
                        CY134676
                        CY134677
                        CY134678
                        CY134679
                        CY134680
                        CY134681
                        CY134682
                        CY134683
                        CY134684
                        CY134685
                        CY134686
                        CY134687
                        CY134688
                        CY134689
                        CY134690
                        CY134691
                        CY134692
                        CY134693
                        CY134694
                        CY134695
                        CY134696
                        CY134697
                        CY134698
                        CY134699
                        CY134700
                        CY134701
                        CY134702
                        CY134703
                        CY134704
                        CY134705
                        CY134706
                        CY134707
                        CY134708
                        CY134709
                        CY134710
                        CY134711
                        CY134712
                        CY134713
                        CY134714
                        CY134715
                        CY134716
                        CY134717
                        CY134718
                        CY134719
                        CY134720
                        CY134721
                        CY134722
                        CY134723
                        CY134724
                        CY134725
                        CY134726
                        CY134727
                        CY134728
                        CY134729
                        CY134730
                        CY134731
                        CY134732
                        CY134733
                        CY134734
                        CY134735
                        CY134736
                        CY134737
                        CY134738
                        CY134739
                        CY134740
                        CY134741
                        CY134742
                        CY134743
                        CY134744
                        CY134745
                        CY134746
                        CY134747
                        CY134748
                        CY134749
                        CY134750
                        CY134751
                        CY134752
                        CY134753
                        CY134754
                        CY134755
                        CY134756
                        CY134757
                        CY134758
                        CY134759
                        CY134760
                        CY134761
                        CY134762
                        CY134763
                        CY134764
                        CY134765
                        CY134766
                        CY134767
                        CY134768
                        CY134769
                        CY134770
                        CY134771
                        CY134772
                        CY134773
                        CY134774
                        CY134775
                        CY134776
                        CY134777
                        CY134778
                        CY134779
                        CY134780
                        CY134781
                        CY134782
                        CY134783
                        CY134784
                        CY134785
                        CY134786
                        CY134787
                        CY134788
                        CY134789
                        CY134790
                        CY134791
                        CY134792
                        CY134793
                        CY134794
                        CY134795
                        CY134796
                        CY134797
                        CY134798
                        CY134799
                        CY134800
                        CY134801
                        CY134802
                        CY134803
                        CY134804
                        CY134805
                        CY134806
                        CY134807
                        CY134808
                        CY134809
                        CY134810
                        CY134811
                        CY134812
                        CY134813
                        CY134814
                        CY134815
                        CY134816
                        CY134817
                        CY134818
                        CY134819
                        CY134820
                        CY134821
                        CY134822
                        CY134823
                        CY134824
                        CY134825
                        CY134826
                        CY134827
                        CY134828
                        CY134829
                        CY134830
                        CY134831
                        CY134832
                        CY134833
                        CY134834
                        CY134835
                        CY134836
                        CY134837
                        CY134838
                        CY134839
                        CY134840
                        CY134841
                        CY134842
                        CY134843
                        CY134844
                        CY134845
                        CY134846
                        CY134847
                        CY134848
                        CY134849
                        CY134850
                        CY134851
                        CY134852
                        CY134853
                        CY134854
                        CY134855
                        CY134856
                        CY134857
                        CY134858
                        CY134859
                        CY134860
                        CY134861
                        CY134862
                        CY134863
                        CY134864
                        CY134865
                        CY134866
                        CY134867
                        CY134868
                        CY134869
                        CY134870
                        CY134871
                        CY134872
                        CY134873
                        CY134874
                        CY134875
                        CY134876
                        CY134877
                        CY134878
                        CY134879
                        CY134880
                        CY134881
                        CY134882
                        CY134883
                        CY134884
                        CY134885
                        CY134886
                        CY134887
                        CY134888
                        CY134889
                        CY134890
                        CY134891
                        CY134892
                        CY134893
                        CY134894
                        CY134895
                        CY134896
                        CY134897
                        CY134898
                        CY134899
                        CY134900
                        CY134901
                        CY134902
                        CY134903
                        CY134904
                        CY134905
                        CY134906
                        CY134907
                        CY134908
                        CY134909
                        CY134910
                        CY134911
                        CY134912
                        CY134913
                        CY134914
                        CY134915
                        CY134916
                        CY134917
                        CY134918
                        CY134919
                        CY134920
                        CY134921
                        CY134922
                        CY134923
                        CY134924
                        CY134925
                        CY134926
                        CY134927
                        CY134928
                        CY134929
                        CY134930
                        CY134931
                        CY134932
                        CY134933
                        CY134934
                        CY134935
                        CY134936
                        CY134937
                        CY134938
                        CY134939
                        CY134940
                        CY134941
                        CY134942
                        CY134943
                        CY134944
                        CY134945
                        CY134946
                        CY134947
                        CY134948
                        CY134949
                        CY134950
                        CY134951
                        CY134952
                        CY134953
                        CY134954
                        CY134955
                        CY134956
                        CY134957
                        CY134958
                        CY134959
                        CY134960
                        CY134961
                        CY134962
                        CY134963
                        CY134964
                        CY134965
                        CY134966
                        CY134967
                        CY134968
                        CY134969
                        CY134970
                        CY134971
                        CY134972
                        CY134973
                        CY134974
                        CY134975
                        CY134976
                        CY134977
                        CY134978
                        CY134979
                        CY134980
                        CY134981
                        CY134982
                        CY134983
                        CY134984
                        CY134985
                        CY134986
                        CY134987
                        CY134988
                        CY134989
                        CY134990
                        CY134991
                        CY134992
                        CY134993
                        CY134994
                        CY134995
                        CY134996
                        CY134997
                        CY134998
                        CY134999
                        CY135000
                        CY135001
                        CY135002
                        CY135003
                        CY135004
                        CY135005
                        CY135006
                        CY135007
                        CY135008
                        CY135009
                        CY135010
                        CY135011
                        CY135012
                        CY135013
                        CY135014
                        CY135015
                        CY135016
                        CY135017
                        CY135018
                        CY135019
                        CY135020
                        CY135021
                        CY135022
                        CY135023
                        CY135024
                        CY135025
                        CY135026
                        CY135027
                        CY135028
                        CY135029
                        CY135030
                        CY135031
                        CY135032
                        CY135033
                        CY135034
                        CY135035
                        CY135036
                        CY135037
                        CY135038
                        CY135039
                        CY135040
                        CY135041
                        CY135042
                        CY135043
                        CY135044
                        CY135045
                        CY135046
                        CY135047
                        CY135048
                        CY135049
                        CY135050
                        CY135051
                        CY135052
                        CY135053
                        CY135054
                        CY135055
                        CY135056
                        CY135057
                        CY135058
                        CY135059
                        CY135060
                        CY135061
                        CY135062
                        CY135063
                        CY135064
                        CY135065
                        CY135066
                        CY135067
                        CY135068
                        CY135069
                        CY135070
                        CY135071
                        CY135072
                        CY135073
                        CY135074
                        CY135075
                        CY135076
                        CY135077
                        CY135078
                        CY135079
                        CY135080
                        CY135081
                        CY135082
                        CY135083
                        CY135084
                        CY135085
                        CY135086
                        CY135087
                        CY135088
                        CY135089
                        CY135090
                        CY135091
                        CY135092
                        CY135093
                        CY135094
                        CY135095
                        CY135096
                        CY135097
                        CY135098
                        CY135099
                        CY135100
                        CY135101
                        CY135102
                        CY135103
                        CY135104
                        CY135105
                        CY135106
                        CY135107
                        CY135124
                        CY135125
                        CY135126
                        CY135127
                        CY135128
                        CY135129
                        CY135130
                        CY135131
                        CY135132
                        CY135133
                        CY135134
                        CY135135
                        CY135136
                        CY135137
                        CY135138
                        CY135139
                        CY135140
                        CY135141
                        CY135142
                        CY135143
                        CY135144
                        CY135145
                        CY135146
                        CY135147
                        CY135148
                        CY135149
                        CY135150
                        CY135151
                        CY135152
                        CY135153
                        CY135154
                        CY135155
                        CY135156
                        CY135157
                        CY135158
                        CY135159
                        CY135160
                        CY135161
                        CY135162
                        CY135163
                        CY135164
                        CY135165
                        CY135166
                        CY135167
                        CY135168
                        CY135169
                        CY135170
                        CY135171
                        CY139611
                        CY139612
                        CY139613
                        CY139614
                        CY139615
                        CY139616
                        CY139617
                        CY139618
                        CY139619
                        CY139620
                        CY139621
                        CY139622
                        CY139623
                        CY139624
                        CY139625
                        CY139626
                        CY139627
                        CY141176
                        CY141177
                        CY141178
                        CY141179
                        CY141180
                        CY141181
                        CY141182
                        CY141183
                        CY141184
                        CY141185
                        CY141186
                        CY141187
                        CY141188
                        CY141189
                        CY141190
                        CY141191
                        CY141192
                        CY141193
                        CY141194
                        CY141195
                        CY141196
                        CY141197
                        CY141199
                        CY141200
                        CY141201
                        CY141202
                        CY141203
                        CY141204
                        CY141205
                        CY141209
                        CY141210
                        CY141211
                        CY141212
                        CY141213
                        CY141214
                        CY141215
                        CY141216
                        CY141218
                        CY141219
                        CY141220
                        CY141221
                        CY141222
                        CY141223
                        CY141224
                        CY141225
                        CY141226
                        CY141227
                        CY141228
                        CY141229
                        CY141230
                        CY141231
                        CY141232
                        CY141234
                        CY141235
                        CY141239
                        CY141240
                        CY141241
                        CY141242
                        CY141243
                        CY141244
                        CY141245
                        CY141246
                        CY141247
                        CY141248
                        CY141249
                        CY141250
                        CY141251
                        CY141252
                        CY141253
                        CY141254
                        CY141255
                        CY141256
                        CY141257
                        CY141259
                        CY141260
                        CY141261
                        CY141262
                        CY141263
                        CY141264
                        CY141265
                        CY141266
                        CY141267
                        CY141268
                        CY141269
                        CY141270
                        CY141271
                        CY141274
                        CY141276
                        CY141277
                        CY141278
                        CY141279
                        CY141280
                        CY141281
                        CY141282
                        CY147290
                        CY147291
                        CY147292
                        CY147293
                        CY147294
                        CY147295
                        CY147296
                        CY147297
                        CY147298
                        CY147299
                        CY147300
                        CY147301
                        CY147302
                        CY147303
                        CY147304
                        CY147305
                        CY147306
                        CY147307
                        CY147308
                        CY147309
                        CY147310
                        CY147311
                        CY148275
                        CY148276
                        CY148277
                        CY148278
                        CY148279
                        CY148280
                        CY148281
                        CY148282
                        CY148292
                        CY148293
                        CY148294
                        CY148295
                        CY148296
                        CY148297
                        CY148298
                        CY148299
                        CY148300
                        CY148301
                        CY148302
                        CY148303
                        CY148304
                        CY148305
                        CY148306
                        CY148307
                        CY148308
                        CY148309
                        CY148310
                        CY148311
                        CY148312
                        CY148313
                        CY148314
                        CY148315
                        CY148324
                        CY148325
                        CY148326
                        CY148327
                        CY148328
                        CY148329
                        CY148330
                        CY148331
                        CY148332
                        CY148333
                        CY148334
                        CY148335
                        CY148336
                        CY148337
                        CY148338
                        CY148339
                        CY148340
                        CY148341
                        CY148342
                        CY148343
                        CY148344
                        CY148345
                        CY148346
                        CY148347
                        CY148348
                        CY148349
                        CY148350
                        CY148351
                        CY148352
                        CY148353
                        CY148354
                        CY148355
                        CY148356
                        CY148357
                        CY148358
                        CY148359
                        CY148360
                        CY148361
                        CY148362
                        CY148363
                        CY148364
                        CY148365
                        CY148366
                        CY148367
                        CY148368
                        CY148369
                        CY148370
                        CY148371
                        CY148372
                        CY148373
                        CY148374
                        CY148375
                        CY148376
                        CY148377
                        CY148378
                        CY148379
                        CY148380
                        CY148381
                        CY148382
                        CY148383
                        CY148384
                        CY148385
                        CY148386
                        CY148387
                        CY148388
                        CY148389
                        CY148390
                        CY148391
                        CY148392
                        CY148393
                        CY148394
                        CY148395
                        CY148396
                        CY148397
                        CY148398
                        CY148399
                        CY148400
                        CY148401
                        CY148402
                        CY148403
                        CY148404
                        CY148405
                        CY148406
                        CY148407
                        CY148408
                        CY148409
                        CY148410
                        CY148411
                        CY148412
                        CY148413
                        CY148414
                        CY148415
                        CY148416
                        CY148417
                        CY148418
                        CY148419
                        CY148420
                        CY148421
                        CY148422
                        CY148423
                        CY148424
                        CY148425
                        CY148426
                        CY148427
                        CY148428
                        CY148429
                        CY148430
                        CY148431
                        CY148432
                        CY148433
                        CY148434
                        CY148435
                        CY148436
                        CY148437
                        CY148438
                        CY148439
                        CY148440
                        CY148441
                        CY148442
                        CY148443
                        CY148444
                        CY148445
                        CY148446
                        CY148447
                        CY148448
                        CY148449
                        CY148450
                        CY148451
                        CY148452
                        CY148453
                        CY148454
                        CY148455
                        CY148456
                        CY148457
                        CY148458
                        CY148459
                        CY148460
                        CY148461
                        CY148462
                        CY148463
                        CY148464
                        CY148465
                        CY148466
                        CY148467
                        CY148468
                        CY148469
                        CY148470
                        CY148471
                        CY148472
                        CY148473
                        CY148474
                        CY148475
                        CY148476
                        CY148477
                        CY148478
                        CY148479
                        CY148480
                        CY148481
                        CY148482
                        CY148483
                        CY148484
                        CY148485
                        CY148486
                        CY148487
                        CY148488
                        CY148489
                        CY148490
                        CY148491
                        CY148492
                        CY148493
                        CY148494
                        CY148495
                        CY148496
                        CY148497
                        CY148498
                        CY148499
                        CY148500
                        CY148501
                        CY148502
                        CY148503
                        CY148504
                        CY148505
                        CY148506
                        CY148507
                        CY148508
                        CY148509
                        CY148510
                        CY148511
                        CY148512
                        CY148513
                        CY148514
                        CY148515
                        CY148516
                        CY148517
                        CY148518
                        CY148519
                        CY148520
                        CY148521
                        CY148522
                        CY148523
                        CY148524
                        CY148525
                        CY148526
                        CY148527
                        CY148528
                        CY148529
                        CY148530
                        CY148531
                        CY148532
                        CY148533
                        CY148534
                        CY148535
                        CY148536
                        CY148537
                        CY148538
                        CY148539
                        CY148540
                        CY148541
                        CY148542
                        CY148543
                        CY148544
                        CY148545
                        CY148546
                        CY148547
                        CY148548
                        CY148549
                        CY148550
                        CY148551
                        CY148552
                        CY148553
                        CY148554
                        CY148555
                        CY148556
                        CY148557
                        CY148558
                        CY148559
                        CY148560
                        CY148561
                        CY148562
                        CY148563
                        CY148564
                        CY148565
                        CY148566
                        CY148567
                        CY148568
                        CY148569
                        CY148570
                        CY148571
                        CY148572
                        CY148573
                        CY148574
                        CY148575
                        CY148576
                        CY148577
                        CY148578
                        CY148579
                        CY148580
                        CY148581
                        CY148582
                        CY148583
                        CY148584
                        CY148585
                        CY148586
                        CY148587
                        CY148588
                        CY148589
                        CY148590
                        CY148591
                        CY148592
                        CY148593
                        CY148594
                        CY148595
                        CY148596
                        CY148597
                        CY148598
                        CY148599
                        CY148600
                        CY148601
                        CY148602
                        CY148603
                        CY148604
                        CY148605
                        CY148606
                        CY148607
                        CY148608
                        CY148609
                        CY148610
                        CY148611
                        CY148612
                        CY148613
                        CY148614
                        CY148615
                        CY148616
                        CY148617
                        CY148618
                        CY148619
                        CY148620
                        CY148621
                        CY148622
                        CY148623
                        CY148624
                        CY148625
                        CY148626
                        CY148627
                        CY148628
                        CY148629
                        CY148630
                        CY148631
                        CY148632
                        CY148633
                        CY148634
                        CY148635
                        CY148636
                        CY148637
                        CY148638
                        CY148639
                        CY148640
                        CY148641
                        CY148642
                        CY148643
                        CY148644
                        CY148645
                        CY148646
                        CY148647
                        CY148648
                        CY148649
                        CY148650
                        CY148651
                        CY148652
                        CY148653
                        CY148654
                        CY148655
                        CY148656
                        CY148657
                        CY148658
                        CY148659
                        CY148660
                        CY148661
                        CY148662
                        CY148663
                        CY148664
                        CY148665
                        CY148666
                        CY148667
                        CY148668
                        CY148669
                        CY148670
                        CY148671
                        CY148672
                        CY148673
                        CY148674
                        CY148675
                        CY148676
                        CY148677
                        CY148678
                        CY148679
                        CY148680
                        CY148681
                        CY148682
                        CY148683
                        CY148684
                        CY148685
                        CY148686
                        CY148687
                        CY148688
                        CY148689
                        CY148690
                        CY148691
                        CY148692
                        CY148693
                        CY148694
                        CY148695
                        CY148696
                        CY148697
                        CY148698
                        CY148699
                        CY148700
                        CY148701
                        CY148702
                        CY148703
                        CY148704
                        CY148705
                        CY148706
                        CY148707
                        CY148708
                        CY148709
                        CY148710
                        CY148711
                        CY148712
                        CY148713
                        CY148714
                        CY148715
                        CY148716
                        CY148717
                        CY148718
                        CY148719
                        CY148720
                        CY148721
                        CY148722
                        CY148723
                        CY148724
                        CY148725
                        CY148726
                        CY148727
                        CY148728
                        CY148729
                        CY148730
                        CY148731
                        CY148732
                        CY148733
                        CY148734
                        CY148735
                        CY148736
                        CY148737
                        CY148738
                        CY148739
                        CY148740
                        CY148741
                        CY148742
                        CY148743
                        CY148744
                        CY148745
                        CY148746
                        CY148747
                        CY148748
                        CY148749
                        CY148750
                        CY148751
                        CY148752
                        CY148753
                        CY148754
                        CY148755
                        CY148756
                        CY148757
                        CY148758
                        CY148759
                        CY148760
                        CY148761
                        CY148762
                        CY148763
                        CY148764
                        CY148765
                        CY148766
                        CY148767
                        CY148768
                        CY148769
                        CY148770
                        CY148771
                        CY148772
                        CY148773
                        CY148774
                        CY148775
                        CY148776
                        CY148777
                        CY148778
                        CY148779
                        CY148780
                        CY148781
                        CY148782
                        CY148783
                        CY148784
                        CY148785
                        CY148786
                        CY148787
                        CY148796
                        CY148797
                        CY148798
                        CY148799
                        CY148800
                        CY148801
                        CY148802
                        CY148803
                        CY148804
                        CY148805
                        CY148806
                        CY148807
                        CY148808
                        CY148809
                        CY148810
                        CY148811
                        CY148812
                        CY148813
                        CY148814
                        CY148815
                        CY148816
                        CY148817
                        CY148818
                        CY148819
                        CY148820
                        CY148821
                        CY148822
                        CY148823
                        CY148824
                        CY148825
                        CY148826
                        CY148827
                        CY148828
                        CY148829
                        CY148830
                        CY148831
                        CY148832
                        CY148833
                        CY148834
                        CY148835
                        CY148836
                        CY148837
                        CY148838
                        CY148839
                        CY148840
                        CY148841
                        CY148842
                        CY148843
                        CY148844
                        CY148845
                        CY148846
                        CY148847
                        CY148848
                        CY148849
                        CY148850
                        CY148851
                        CY148852
                        CY148853
                        CY148854
                        CY148855
                        CY148856
                        CY148857
                        CY148858
                        CY148859
                        CY148860
                        CY148861
                        CY148862
                        CY148863
                        CY148864
                        CY148865
                        CY148866
                        CY148867
                        CY148868
                        CY148869
                        CY148870
                        CY148871
                        CY148872
                        CY148873
                        CY148874
                        CY148875
                        CY148876
                        CY148877
                        CY148878
                        CY148879
                        CY148880
                        CY148881
                        CY148882
                        CY148883
                        CY148884
                        CY148885
                        CY148886
                        CY148887
                        CY148888
                        CY148889
                        CY148890
                        CY148891
                        CY148892
                        CY148893
                        CY148894
                        CY148895
                        CY148896
                        CY148897
                        CY148898
                        CY148899
                        CY148900
                        CY148901
                        CY148902
                        CY148903
                        CY148904
                        CY148905
                        CY148906
                        CY148907
                        CY148908
                        CY148909
                        CY148910
                        CY148911
                        CY148912
                        CY148913
                        CY148914
                        CY148915
                        CY148916
                        CY148917
                        CY148918
                        CY148919
                        CY148920
                        CY148921
                        CY148922
                        CY148923
                        CY148924
                        CY148925
                        CY148926
                        CY148927
                        CY148928
                        CY148929
                        CY148930
                        CY148931
                        CY148932
                        CY148933
                        CY148934
                        CY148935
                        CY148936
                        CY148937
                        CY148938
                        CY148939
                        CY148940
                        CY148941
                        CY148942
                        CY148943
                        CY148944
                        CY148945
                        CY148946
                        CY148947
                        CY148948
                        CY148949
                        CY148950
                        CY148951
                        CY148952
                        CY148953
                        CY148954
                        CY148955
                        CY148956
                        CY148957
                        CY148958
                        CY148959
                        CY148960
                        CY148961
                        CY148962
                        CY148963
                        CY148964
                        CY148965
                        CY148966
                        CY148967
                        CY148968
                        CY148969
                        CY148970
                        CY148971
                        CY148972
                        CY148973
                        CY148974
                        CY148975
                        CY148976
                        CY148977
                        CY148978
                        CY148979
                        CY148980
                        CY148981
                        CY148982
                        CY148983
                        CY148984
                        CY148985
                        CY148986
                        CY148987
                        CY148988
                        CY148989
                        CY148990
                        CY148991
                        CY148992
                        CY148993
                        CY148994
                        CY148995
                        CY148996
                        CY148997
                        CY148998
                        CY148999
                        CY149000
                        CY149001
                        CY149002
                        CY149003
                        CY149004
                        CY149005
                        CY149006
                        CY149007
                        CY149008
                        CY149009
                        CY149010
                        CY149011
                        CY149012
                        CY149013
                        CY149014
                        CY149015
                        CY149016
                        CY149017
                        CY149018
                        CY149019
                        CY149020
                        CY149021
                        CY149022
                        CY149023
                        CY149024
                        CY149025
                        CY149026
                        CY149027
                        CY149028
                        CY149029
                        CY149030
                        CY149031
                        CY149032
                        CY149033
                        CY149034
                        CY149035
                        CY149036
                        CY149037
                        CY149038
                        CY149039
                        CY149040
                        CY149041
                        CY149042
                        CY149043
                        CY149044
                        CY149045
                        CY149046
                        CY149047
                        CY149048
                        CY149049
                        CY149050
                        CY149051
                        CY149052
                        CY149053
                        CY149054
                        CY149055
                        CY149056
                        CY149057
                        CY149058
                        CY149059
                        CY149060
                        CY149061
                        CY149062
                        CY149063
                        CY149064
                        CY149065
                        CY149066
                        CY149067
                        CY149068
                        CY149069
                        CY149070
                        CY149071
                        CY149072
                        CY149073
                        CY149074
                        CY149075
                        CY149076
                        CY149077
                        CY149078
                        CY149079
                        CY149080
                        CY149081
                        CY149082
                        CY149083
                        CY149084
                        CY149085
                        CY149086
                        CY149087
                        CY149088
                        CY149089
                        CY149090
                        CY149091
                        CY149092
                        CY149093
                        CY149094
                        CY149095
                        CY149096
                        CY149097
                        CY149098
                        CY149099
                        CY149100
                        CY149101
                        CY149102
                        CY149103
                        CY149104
                        CY149105
                        CY149106
                        CY149107
                        CY149108
                        CY149109
                        CY149110
                        CY149111
                        CY149112
                        CY149113
                        CY149114
                        CY149115
                        CY149116
                        CY149117
                        CY149118
                        CY149119
                        CY149120
                        CY149121
                        CY149122
                        CY149123
                        CY149124
                        CY149125
                        CY149126
                        CY149127
                        CY149128
                        CY149129
                        CY149130
                        CY149131
                        CY149132
                        CY149133
                        CY149134
                        CY149135
                        CY149136
                        CY149137
                        CY149138
                        CY149139
                        CY149140
                        CY149141
                        CY149142
                        CY149143
                        CY149144
                        CY149145
                        CY149146
                        CY149147
                        CY149148
                        CY149149
                        CY149150
                        CY149151
                        CY149152
                        CY149153
                        CY149154
                        CY149155
                        CY149156
                        CY149157
                        CY149158
                        CY149159
                        CY149160
                        CY149161
                        CY149162
                        CY149163
                        CY149164
                        CY149165
                        CY149166
                        CY149167
                        CY149168
                        CY149169
                        CY149170
                        CY149171
                        CY149172
                        CY149173
                        CY149174
                        CY149175
                        CY149176
                        CY149177
                        CY149178
                        CY149179
                        CY149180
                        CY149181
                        CY149182
                        CY149183
                        CY149184
                        CY149185
                        CY149186
                        CY149187
                        CY149188
                        CY149189
                        CY149190
                        CY149191
                        CY149192
                        CY149193
                        CY149194
                        CY149195
                        CY149196
                        CY149197
                        CY149198
                        CY149199
                        CY149200
                        CY149201
                        CY149202
                        CY149203
                        CY149204
                        CY149205
                        CY149206
                        CY149207
                        CY149208
                        CY149209
                        CY149210
                        CY149211
                        CY149212
                        CY149213
                        CY149214
                        CY149215
                        CY149216
                        CY149217
                        CY149218
                        CY149219
                        CY149220
                        CY149221
                        CY149222
                        CY149223
                        CY149224
                        CY149225
                        CY149226
                        CY149227
                        CY149228
                        CY149229
                        CY149230
                        CY149231
                        CY149232
                        CY149233
                        CY149234
                        CY149235
                        CY149236
                        CY149237
                        CY149238
                        CY149239
                        CY149240
                        CY149241
                        CY149242
                        CY149243
                        CY149244
                        CY149245
                        CY149246
                        CY149247
                        CY149248
                        CY149249
                        CY149250
                        CY149251
                        CY149252
                        CY149253
                        CY149254
                        CY149255
                        CY149256
                        CY149257
                        CY149258
                        CY149259
                        CY149260
                        CY149261
                        CY149262
                        CY149263
                        CY149264
                        CY149265
                        CY149266
                        CY149267
                        CY149268
                        CY149269
                        CY149270
                        CY149271
                        CY149272
                        CY149273
                        CY149274
                        CY149275
                        CY149276
                        CY149277
                        CY149278
                        CY149279
                        CY149280
                        CY149281
                        CY149282
                        CY149283
                        CY149284
                        CY149285
                        CY149286
                        CY149287
                        CY149288
                        CY149289
                        CY149290
                        CY149291
                        CY149292
                        CY149293
                        CY149294
                        CY149295
                        CY149296
                        CY149297
                        CY149298
                        CY149299
                        CY149300
                        CY149301
                        CY149302
                        CY149303
                        CY149304
                        CY149305
                        CY149306
                        CY149307
                        CY149308
                        CY149309
                        CY149310
                        CY149311
                        CY149312
                        CY149313
                        CY149314
                        CY149315
                        CY149316
                        CY149317
                        CY149318
                        CY149319
                        CY149320
                        CY149321
                        CY149322
                        CY149323
                        CY149324
                        CY149325
                        CY149326
                        CY149327
                        CY149328
                        CY149329
                        CY149330
                        CY149331
                        CY160528
                        CY160529
                        CY160530
                        CY160531
                        CY160532
                        CY160533
                        CY160534
                        CY160535
                        CY163168
                        CY163169
                        CY163170
                        CY163171
                        CY163172
                        CY163173
                        CY163174
                        CY163175
                        CY163422
                        CY163423
                        CY163424
                        CY163425
                        CY163426
                        CY163427
                        CY163428
                        CY163429
                        CY167788
                        CY167789
                        CY167790
                        CY167791
                        CY167792
                        CY167793
                        CY167794
                        CY167795
                        CY167796
                        CY167797
                        CY167798
                        CY167799
                        CY167800
                        CY167801
                        CY167802
                        CY167803
                        CY167852
                        CY167853
                        CY167854
                        CY167855
                        CY167856
                        CY167857
                        CY167858
                        CY167859
                        CY167860
                        CY167861
                        CY167862
                        CY167863
                        CY167864
                        CY167865
                        CY167866
                        CY167867
                        CY167868
                        CY167869
                        CY167870
                        CY167871
                        CY167872
                        CY167873
                        CY167874
                        CY167875
                        CY167887
                        CY167888
                        CY167889
                        CY167890
                        CY167891
                        CY167892
                        CY167893
                        CY167894
                        CY167895
                        CY167896
                        CY167897
                        CY167898
                        CY167899
                        CY167900
                        CY167901
                        CY167902
                        CY167903
                        CY167904
                        CY167905
                        CY167906
                        CY167907
                        CY167908
                        CY167909
                        CY167910
                        CY167911
                        CY167912
                        CY167913
                        CY167914
                        CY167915
                        CY167916
                        CY167917
                        CY167918
                        CY167919
                        CY167920
                        CY167921
                        CY167922
                        CY167923
                        CY167924
                        CY167925
                        CY167926
                        CY167927
                        CY167928
                        CY167929
                        CY167930
                        CY167931
                        CY167932
                        CY167933
                        CY167934
                        CY167935
                        CY167936
                        CY167937
                        CY167938
                        CY167939
                        CY167940
                        CY167941
                        CY167942
                        CY167943
                        CY167944
                        CY167945
                        CY167946
                        CY167947
                        CY167948
                        CY167949
                        CY167950
                        CY167951
                        CY167952
                        CY167953
                        CY167954
                        CY167955
                        CY167956
                        CY167957
                        CY167958
                        CY167959
                        CY167960
                        CY167961
                        CY167962
                        CY167963
                        CY167964
                        CY167965
                        CY167966
                        CY167967
                        CY167968
                        CY167969
                        CY167970
                        CY167971
                        CY167972
                        CY167973
                        CY167974
                        CY167975
                        CY167976
                        CY167977
                        CY167978
                        CY167979
                        CY167980
                        CY167981
                        CY167982
                        CY167983
                        CY167984
                        CY167985
                        CY167986
                        CY167987
                        CY167988
                        CY167989
                        CY167990
                        CY167991
                        CY167992
                        CY167993
                        CY167994
                        CY167995
                        CY167996
                        CY167997
                        CY167998
                        CY167999
                        CY168000
                        CY168001
                        CY168002
                        CY168003
                        CY168004
                        CY168005
                        CY168006
                        CY168007
                        CY168008
                        CY168009
                        CY168010
                        CY168011
                        CY168012
                        CY168013
                        CY168014
                        CY168015
                        CY168016
                        CY168017
                        CY168018
                        CY168019
                        CY168020
                        CY168021
                        CY168022
                        CY168023
                        CY168024
                        CY168025
                        CY168026
                        CY168027
                        CY168028
                        CY168029
                        CY168030
                        CY168031
                        CY168032
                        CY168033
                        CY168034
                        CY168035
                        CY168036
                        CY168037
                        CY168038
                        CY168039
                        CY168040
                        CY168041
                        CY168042
                        CY168043
                        CY168044
                        CY168045
                        CY168046
                        CY168047
                        CY168048
                        CY168049
                        CY168050
                        CY168051
                        CY168052
                        CY168053
                        CY168054
                        CY168055
                        CY168056
                        CY168057
                        CY168058
                        CY168059
                        CY168060
                        CY168061
                        CY168062
                        CY168063
                        CY168064
                        CY168065
                        CY168066
                        CY168067
                        CY168068
                        CY168069
                        CY168070
                        CY168071
                        CY168072
                        CY168073
                        CY168074
                        CY168075
                        CY168076
                        CY168077
                        CY168078
                        CY168079
                        CY168080
                        CY168081
                        CY168082
                        CY168083
                        CY168084
                        CY168085
                        CY168086
                        CY168087
                        CY168088
                        CY168089
                        CY168090
                        CY168091
                        CY168092
                        CY168093
                        CY168094
                        CY168103
                        CY168104
                        CY168105
                        CY168106
                        CY168107
                        CY168108
                        CY168109
                        CY168110
                        CY168111
                        CY168112
                        CY168113
                        CY168114
                        CY168115
                        CY168116
                        CY168117
                        CY168118
                        CY168119
                        CY168120
                        CY168121
                        CY168122
                        CY168123
                        CY168124
                        CY168125
                        CY168126
                        CY168127
                        CY168128
                        CY168129
                        CY168130
                        CY168131
                        CY168132
                        CY168133
                        CY168134
                        CY168135
                        CY168136
                        CY168137
                        CY168138
                        CY168139
                        CY168140
                        CY168141
                        CY168142
                        CY168143
                        CY168144
                        CY168145
                        CY168146
                        CY168147
                        CY168148
                        CY168149
                        CY168150
                        CY168151
                        CY168152
                        CY168153
                        CY168154
                        CY168155
                        CY168156
                        CY168157
                        CY168158
                        CY168159
                        CY168160
                        CY168161
                        CY168162
                        CY168163
                        CY168164
                        CY168165
                        CY168166
                        CY168167
                        CY168168
                        CY168169
                        CY168170
                        CY168171
                        CY168172
                        CY168173
                        CY168174
                        CY168175
                        CY168176
                        CY168177
                        CY168178
                        CY168179
                        CY168180
                        CY168181
                        CY168182
                        CY168183
                        CY168184
                        CY168185
                        CY168186
                        CY168187
                        CY168188
                        CY168189
                        CY168190
                        CY168191
                        CY168192
                        CY168193
                        CY168194
                        CY168195
                        CY168196
                        CY168197
                        CY168198
                        CY168199
                        CY168200
                        CY168201
                        CY168202
                        CY168203
                        CY168204
                        CY168205
                        CY168206
                        CY168207
                        CY168208
                        CY168209
                        CY168210
                        CY168211
                        CY168212
                        CY168213
                        CY168214
                        CY168215
                        CY168216
                        CY168217
                        CY168218
                        CY168219
                        CY168220
                        CY168221
                        CY168222
                        CY168223
                        CY168224
                        CY168225
                        CY168226
                        CY168227
                        CY168228
                        CY168229
                        CY168230
                        CY168231
                        CY168232
                        CY168233
                        CY168234
                        CY168235
                        CY168236
                        CY168237
                        CY168238
                        CY168239
                        CY168240
                        CY168241
                        CY168242
                        CY168243
                        CY168244
                        CY168245
                        CY168246
                        CY168247
                        CY168248
                        CY168249
                        CY168250
                        CY168251
                        CY168252
                        CY168253
                        CY168254
                        CY168255
                        CY168256
                        CY168257
                        CY168258
                        CY168259
                        CY168260
                        CY168261
                        CY168262
                        CY168263
                        CY168264
                        CY168265
                        CY168266
                        CY168267
                        CY168268
                        CY168269
                        CY168270
                        CY168271
                        CY168272
                        CY168273
                        CY168274
                        CY168275
                        CY168276
                        CY168277
                        CY168278
                        CY168279
                        CY168280
                        CY168281
                        CY168282
                        CY168283
                        CY168284
                        CY168285
                        CY168286
                        CY168287
                        CY168288
                        CY168289
                        CY168290
                        CY168291
                        CY168292
                        CY168293
                        CY168294
                        CY168295
                        CY168296
                        CY168297
                        CY168298
                        CY168299
                        CY168300
                        CY168301
                        CY168302
                        CY168303
                        CY168304
                        CY168305
                        CY168306
                        CY168307
                        CY168308
                        CY168309
                        CY168310
                        CY168311
                        CY168312
                        CY168313
                        CY168314
                        CY168315
                        CY168316
                        CY168317
                        CY168318
                        CY168319
                        CY168320
                        CY168321
                        CY168322
                        CY168323
                        CY168324
                        CY168325
                        CY168326
                        CY168327
                        CY168328
                        CY168329
                        CY168330
                        CY168331
                        CY168332
                        CY168333
                        CY168334
                        CY168335
                        CY168336
                        CY168337
                        CY168338
                        CY168339
                        CY168340
                        CY168341
                        CY168342
                        CY168343
                        CY168344
                        CY168345
                        CY168346
                        CY168347
                        CY168348
                        CY168349
                        CY168350
                        CY168351
                        CY168352
                        CY168353
                        CY168354
                        CY168355
                        CY168356
                        CY168357
                        CY168358
                        CY168359
                        CY168360
                        CY168361
                        CY168362
                        CY168363
                        CY168364
                        CY168365
                        CY168366
                        CY168367
                        CY168368
                        CY168369
                        CY168370
                        CY168371
                        CY168372
                        CY168373
                        CY168374
                        CY168375
                        CY168376
                        CY168377
                        CY168378
                        CY168379
                        CY168380
                        CY168381
                        CY168382
                        CY168383
                        CY168384
                        CY168385
                        CY168386
                        CY168387
                        CY168388
                        CY168389
                        CY168390
                        CY168391
                        CY168392
                        CY168393
                        CY168394
                        CY168395
                        CY168396
                        CY168397
                        CY168398
                        CY168399
                        CY168400
                        CY168401
                        CY168402
                        CY168403
                        CY168404
                        CY168405
                        CY168406
                        CY168407
                        CY168408
                        CY168409
                        CY168410
                        CY168411
                        CY168412
                        CY168413
                        CY168414
                        CY168415
                        CY168416
                        CY168417
                        CY168418
                        CY168419
                        CY168420
                        CY168421
                        CY168422
                        CY168431
                        CY168432
                        CY168433
                        CY168434
                        CY168435
                        CY168436
                        CY168437
                        CY168438
                        CY168439
                        CY168440
                        CY168441
                        CY168442
                        CY168443
                        CY168444
                        CY168445
                        CY168446
                        CY168447
                        CY168448
                        CY168449
                        CY168450
                        CY168451
                        CY168452
                        CY168453
                        CY168454
                        CY168455
                        CY168456
                        CY168457
                        CY168458
                        CY168459
                        CY168460
                        CY168461
                        CY168462
                        CY168463
                        CY168464
                        CY168465
                        CY168466
                        CY168467
                        CY168468
                        CY168469
                        CY168470
                        CY168471
                        CY168472
                        CY168473
                        CY168474
                        CY168475
                        CY168476
                        CY168477
                        CY168478
                        CY168479
                        CY168480
                        CY168481
                        CY168482
                        CY168483
                        CY168484
                        CY168485
                        CY168486
                        CY168487
                        CY168488
                        CY168489
                        CY168490
                        CY168491
                        CY168492
                        CY168493
                        CY168494
                        CY168495
                        CY168496
                        CY168497
                        CY168498
                        CY168499
                        CY168500
                        CY168501
                        CY168502
                        CY168503
                        CY168504
                        CY168505
                        CY168506
                        CY168507
                        CY168508
                        CY168509
                        CY168510
                        CY168511
                        CY168512
                        CY168513
                        CY168514
                        CY168515
                        CY168516
                        CY168517
                        CY168518
                        CY168519
                        CY168520
                        CY168521
                        CY168522
                        CY168523
                        CY168524
                        CY168525
                        CY168526
                        CY168743
                        CY168744
                        CY168745
                        CY168746
                        CY168747
                        CY168748
                        CY168749
                        CY168750
                        CY168839
                        CY168840
                        CY168841
                        CY168842
                        CY168843
                        CY168844
                        CY168845
                        CY168846
                        CY170103
                        CY170104
                        CY170105
                        CY170106
                        CY170107
                        CY170108
                        CY170109
                        CY170110
                        CY170111
                        CY170112
                        CY170113
                        CY170114
                        CY170115
                        CY170116
                        CY170117
                        CY170118
                        CY170119
                        CY170120
                        CY170121
                        CY170122
                        CY170123
                        CY170124
                        CY170125
                        CY170126
                        CY170127
                        CY170128
                        CY170129
                        CY170130
                        CY170131
                        CY170132
                        CY170133
                        CY170134
                        CY170135
                        CY170136
                        CY170137
                        CY170138
                        CY170139
                        CY170140
                        CY170141
                        CY170142
                        CY170143
                        CY170144
                        CY170145
                        CY170146
                        CY170147
                        CY170148
                        CY170149
                        CY170150
                        CY170151
                        CY170152
                        CY170153
                        CY170154
                        CY170155
                        CY170156
                        CY170157
                        CY170158
                        CY170159
                        CY170160
                        CY170161
                        CY170162
                        CY170163
                        CY170164
                        CY170165
                        CY170166
                        CY170167
                        CY170168
                        CY170169
                        CY170170
                        CY170171
                        CY170172
                        CY170173
                        CY170174
                        CY170175
                        CY170176
                        CY170177
                        CY170178
                        CY170179
                        CY170180
                        CY170181
                        CY170182
                        CY170183
                        CY170184
                        CY170185
                        CY170186
                        CY170187
                        CY170188
                        CY170189
                        CY170190
                        CY170191
                        CY170192
                        CY170193
                        CY170194
                        CY170195
                        CY170196
                        CY170197
                        CY170198
                        CY170199
                        CY170200
                        CY170201
                        CY170202
                        CY170203
                        CY170204
                        CY170205
                        CY170206
                        CY170207
                        CY170208
                        CY170209
                        CY170210
                        CY170211
                        CY170212
                        CY170213
                        CY170214
                        CY170215
                        CY170216
                        CY170217
                        CY170218
                        CY170219
                        CY170220
                        CY170221
                        CY170222
                        CY170223
                        CY170224
                        CY170225
                        CY170226
                        CY170227
                        CY170228
                        CY170229
                        CY170230
                        CY170231
                        CY170232
                        CY170233
                        CY170234
                        CY170235
                        CY170236
                        CY170237
                        CY170238
                        CY170239
                        CY170240
                        CY170241
                        CY170242
                        CY170243
                        CY170244
                        CY170245
                        CY170246
                        CY170247
                        CY170248
                        CY170249
                        CY170250
                        CY170251
                        CY170252
                        CY170253
                        CY170254
                        CY170263
                        CY170264
                        CY170265
                        CY170266
                        CY170267
                        CY170268
                        CY170269
                        CY170270
                        CY170271
                        CY170272
                        CY170273
                        CY170274
                        CY170275
                        CY170276
                        CY170277
                        CY170278
                        CY170279
                        CY170280
                        CY170281
                        CY170282
                        CY170283
                        CY170284
                        CY170285
                        CY170286
                        CY170287
                        CY170288
                        CY170289
                        CY170290
                        CY170291
                        CY170292
                        CY170293
                        CY170294
                        CY170295
                        CY170296
                        CY170297
                        CY170298
                        CY170299
                        CY170300
                        CY170301
                        CY170302
                        CY170303
                        CY170304
                        CY170305
                        CY170306
                        CY170307
                        CY170308
                        CY170309
                        CY170310
                        CY170311
                        CY170312
                        CY170313
                        CY170314
                        CY170315
                        CY170316
                        CY170317
                        CY170318
                        CY170319
                        CY170320
                        CY170321
                        CY170322
                        CY170323
                        CY170324
                        CY170325
                        CY170326
                        CY170327
                        CY170328
                        CY170329
                        CY170330
                        CY170331
                        CY170332
                        CY170333
                        CY170334
                        CY170335
                        CY170336
                        CY170337
                        CY170338
                        CY170339
                        CY170340
                        CY170341
                        CY170342
                        CY170343
                        CY170344
                        CY170345
                        CY170346
                        CY170347
                        CY170348
                        CY170349
                        CY170350
                        CY170351
                        CY170352
                        CY170353
                        CY170354
                        CY170355
                        CY170356
                        CY170357
                        CY170358
                        CY170359
                        CY170360
                        CY170361
                        CY170362
                        CY170363
                        CY170364
                        CY170365
                        CY170366
                        CY170367
                        CY170368
                        CY170369
                        CY170370
                        CY170371
                        CY170372
                        CY170373
                        CY170374
                        CY170375
                        CY170376
                        CY170377
                        CY170378
                        CY170379
                        CY170380
                        CY170381
                        CY170382
                        CY170383
                        CY170384
                        CY170385
                        CY170386
                        CY170387
                        CY170388
                        CY170389
                        CY170390
                        CY170391
                        CY170392
                        CY170393
                        CY170394
                        CY170395
                        CY170396
                        CY170397
                        CY170398
                        CY170399
                        CY170400
                        CY170401
                        CY170402
                        CY170403
                        CY170404
                        CY170405
                        CY170406
                        CY170407
                        CY170408
                        CY170409
                        CY170410
                        CY170411
                        CY170412
                        CY170413
                        CY170414
                        CY170415
                        CY170416
                        CY170417
                        CY170418
                        CY170419
                        CY170420
                        CY170421
                        CY170422
                        CY170423
                        CY170424
                        CY170425
                        CY170426
                        CY170427
                        CY170428
                        CY170429
                        CY170430
                        CY170431
                        CY170432
                        CY170433
                        CY170434
                        CY170435
                        CY170436
                        CY170437
                        CY170438
                        CY170439
                        CY170440
                        CY170441
                        CY170442
                        CY170443
                        CY170444
                        CY170445
                        CY170446
                        CY170447
                        CY170448
                        CY170449
                        CY170450
                        CY170451
                        CY170452
                        CY170453
                        CY170454
                        CY170455
                        CY170456
                        CY170457
                        CY170458
                        CY170459
                        CY170460
                        CY170461
                        CY170462
                        CY170463
                        CY170464
                        CY170465
                        CY170466
                        CY170467
                        CY170468
                        CY170469
                        CY170470
                        CY170471
                        CY170472
                        CY170473
                        CY170474
                        CY170475
                        CY170476
                        CY170477
                        CY170478
                        CY170479
                        CY170480
                        CY170481
                        CY170482
                        CY170483
                        CY170484
                        CY170485
                        CY170486
                        CY170487
                        CY170488
                        CY170489
                        CY170490
                        CY170491
                        CY170492
                        CY170493
                        CY170494
                        CY170495
                        CY170496
                        CY170497
                        CY170498
                        CY170499
                        CY170500
                        CY170501
                        CY170502
                        CY170503
                        CY170504
                        CY170505
                        CY170506
                        CY170507
                        CY170508
                        CY170509
                        CY170510
                        CY170511
                        CY170512
                        CY170513
                        CY170514
                        CY170515
                        CY170516
                        CY170517
                        CY170518
                        CY170519
                        CY170520
                        CY170521
                        CY170522
                        CY170523
                        CY170524
                        CY170525
                        CY170526
                        CY170527
                        CY170528
                        CY170529
                        CY170530
                        CY170531
                        CY170532
                        CY170533
                        CY170534
                        CY170535
                        CY170536
                        CY170537
                        CY170538
                        CY170539
                        CY170540
                        CY170541
                        CY170542
                        CY170543
                        CY170544
                        CY170545
                        CY170546
                        CY170547
                        CY170548
                        CY170549
                        CY170550
                        CY170551
                        CY170552
                        CY170553
                        CY170554
                        CY170555
                        CY170556
                        CY170557
                        CY170558
                        CY170559
                        CY170560
                        CY170561
                        CY170562
                        CY170563
                        CY170564
                        CY170565
                        CY170566
                        CY170567
                        CY170568
                        CY170569
                        CY170570
                        CY170571
                        CY170572
                        CY170573
                        CY170574
                        CY170575
                        CY170576
                        CY170577
                        CY170578
                        CY170579
                        CY170580
                        CY170581
                        CY170582
                        CY170583
                        CY170584
                        CY170585
                        CY170586
                        CY170587
                        CY170588
                        CY170589
                        CY170590
                        CY170591
                        CY170592
                        CY170593
                        CY170594
                        CY170595
                        CY170596
                        CY170597
                        CY170598
                        CY170599
                        CY170600
                        CY170601
                        CY170602
                        CY170603
                        CY170604
                        CY170605
                        CY170606
                        CY170607
                        CY170608
                        CY170609
                        CY170610
                        CY170611
                        CY170612
                        CY170613
                        CY170614
                        CY170615
                        CY170616
                        CY170617
                        CY170618
                        CY170619
                        CY170620
                        CY170621
                        CY170622
                        CY170623
                        CY170624
                        CY170625
                        CY170626
                        CY170627
                        CY170628
                        CY170629
                        CY170630
                        CY170631
                        CY170632
                        CY170633
                        CY170634
                        CY170635
                        CY170636
                        CY170637
                        CY170638
                        CY170639
                        CY170640
                        CY170641
                        CY170642
                        CY170643
                        CY170644
                        CY170645
                        CY170646
                        CY170647
                        CY170648
                        CY170649
                        CY170650
                        CY170651
                        CY170652
                        CY170653
                        CY170654
                        CY170655
                        CY170656
                        CY170657
                        CY170658
                        CY170659
                        CY170660
                        CY170661
                        CY170662
                        CY170663
                        CY170664
                        CY170665
                        CY170666
                        CY170667
                        CY170668
                        CY170669
                        CY170670
                        CY170687
                        CY170688
                        CY170689
                        CY170690
                        CY170691
                        CY170692
                        CY170693
                        CY170694
                        CY170703
                        CY170704
                        CY170705
                        CY170706
                        CY170707
                        CY170708
                        CY170709
                        CY170710
                        CY170711
                        CY170712
                        CY170713
                        CY170714
                        CY170715
                        CY170716
                        CY170717
                        CY170718
                        CY170719
                        CY170720
                        CY170721
                        CY170722
                        CY170723
                        CY170724
                        CY170725
                        CY170726
                        CY170727
                        CY170728
                        CY170729
                        CY170730
                        CY170731
                        CY170732
                        CY170733
                        CY170734
                        CY170735
                        CY170736
                        CY170737
                        CY170738
                        CY170739
                        CY170740
                        CY170741
                        CY170742
                        CY170743
                        CY170744
                        CY170745
                        CY170746
                        CY170747
                        CY170748
                        CY170749
                        CY170750
                        CY170751
                        CY170752
                        CY170753
                        CY170754
                        CY170755
                        CY170756
                        CY170757
                        CY170758
                        CY170759
                        CY170760
                        CY170761
                        CY170762
                        CY170763
                        CY170764
                        CY170765
                        CY170766
                        CY170767
                        CY170768
                        CY170769
                        CY170770
                        CY170771
                        CY170772
                        CY170773
                        CY170774
                        CY170775
                        CY170776
                        CY170777
                        CY170778
                        CY170779
                        CY170780
                        CY170781
                        CY170782
                        CY170783
                        CY170784
                        CY170785
                        CY170786
                        CY170787
                        CY170788
                        CY170789
                        CY170790
                        CY170791
                        CY170792
                        CY170793
                        CY170794
                        CY170795
                        CY170796
                        CY170797
                        CY170798
                        CY170799
                        CY170800
                        CY170801
                        CY170802
                        CY170803
                        CY170804
                        CY170805
                        CY170806
                        CY170807
                        CY170808
                        CY170809
                        CY170810
                        CY170811
                        CY170812
                        CY170813
                        CY170814
                        CY170815
                        CY170816
                        CY170817
                        CY170818
                        CY170819
                        CY170820
                        CY170821
                        CY170822
                        CY170823
                        CY170824
                        CY170825
                        CY170826
                        CY170827
                        CY170828
                        CY170829
                        CY170830
                        CY170831
                        CY170832
                        CY170833
                        CY170834
                        CY170835
                        CY170836
                        CY170837
                        CY170838
                        CY170847
                        CY170848
                        CY170849
                        CY170850
                        CY170851
                        CY170852
                        CY170853
                        CY170854
                        CY170855
                        CY170856
                        CY170857
                        CY170858
                        CY170859
                        CY170860
                        CY170861
                        CY170862
                        CY170863
                        CY170864
                        CY170865
                        CY170866
                        CY170867
                        CY170868
                        CY170869
                        CY170870
                        CY170871
                        CY170872
                        CY170873
                        CY170874
                        CY170875
                        CY170876
                        CY170877
                        CY170878
                        CY170879
                        CY170880
                        CY170881
                        CY170882
                        CY170883
                        CY170884
                        CY170885
                        CY170886
                        CY170887
                        CY170888
                        CY170889
                        CY170890
                        CY170891
                        CY170892
                        CY170893
                        CY170894
                        CY170895
                        CY170896
                        CY170897
                        CY170898
                        CY170899
                        CY170900
                        CY170901
                        CY170902
                        CY170903
                        CY170904
                        CY170905
                        CY170906
                        CY170907
                        CY170908
                        CY170909
                        CY170910
                        CY170911
                        CY170912
                        CY170913
                        CY170914
                        CY170915
                        CY170916
                        CY170917
                        CY170918
                        CY170919
                        CY170920
                        CY170921
                        CY170922
                        CY170923
                        CY170924
                        CY170925
                        CY170926
                        CY170935
                        CY170936
                        CY170937
                        CY170938
                        CY170939
                        CY170940
                        CY170941
                        CY170942
                        CY170943
                        CY170944
                        CY170945
                        CY170946
                        CY170947
                        CY170948
                        CY170949
                        CY170950
                        CY170951
                        CY170952
                        CY170953
                        CY170954
                        CY170955
                        CY170956
                        CY170957
                        CY170958
                        CY170959
                        CY170960
                        CY170961
                        CY170962
                        CY170963
                        CY170964
                        CY170965
                        CY170966
                        CY170967
                        CY170968
                        CY170969
                        CY170970
                        CY170971
                        CY170972
                        CY170973
                        CY170974
                        CY170975
                        CY170976
                        CY170977
                        CY170978
                        CY170979
                        CY170980
                        CY170981
                        CY170982
                        CY170983
                        CY170984
                        CY170985
                        CY170986
                        CY170987
                        CY170988
                        CY170989
                        CY170990
                        CY170991
                        CY170992
                        CY170993
                        CY170994
                        CY170995
                        CY170996
                        CY170997
                        CY170998
                        CY170999
                        CY171000
                        CY171001
                        CY171002
                        CY171003
                        CY171004
                        CY171005
                        CY171006
                        CY171007
                        CY171008
                        CY171009
                        CY171010
                        CY171011
                        CY171012
                        CY171013
                        CY171014
                        CY171015
                        CY171016
                        CY171017
                        CY171018
                        CY171019
                        CY171020
                        CY171021
                        CY171022
                        CY171023
                        CY171024
                        CY171025
                        CY171026
                        CY171027
                        CY171028
                        CY171029
                        CY171030
                        CY171031
                        CY171032
                        CY171033
                        CY171034
                        CY171035
                        CY171036
                        CY171037
                        CY171038
                        CY171039
                        CY171040
                        CY171041
                        CY171042
                        CY171043
                        CY171044
                        CY171045
                        CY171046
                        JX656751
                        JX656752
                        KC291191
                        KC526204
                        KC526205
                        KC526206
                        KC526207
                        KC526208
                        KC526209
                        KC526210
                        KC526211
                        KC526212
                        KC526213
                        KC526214
                        KC535019
                        KC535020
                        KC535021
                        KC535022
                        KC535023
                        KC535024
                        KC535025
                        KC535026
                        KC535027
                        KC535028
                        KC535029
                        KC535030
                        KC535031
                        KC535032
                        KC535033
                        KC535034
                        KC535035
                        KC535036
                        KC535037
                        KC535038
                        KC535039
                        KC535040
                        KC535041
                        KC535042
                        KC535043
                        KC535044
                        KC535045
                        KC535046
                        KC535047
                        KC535048
                        KC535049
                        KC535050
                        KC535051
                        KC535052
                        KC535053
                        KC535054
                        KC535055
                        KC535056
                        KC535057
                        KC535058
                        KC535059
                        KC535060
                        KC535061
                        KC535062
                        KC535063
                        KC535064
                        KC539112
                        KC539113
                        KC539114
                        KC539115
                        KC539116
                        KC539117
                        KC539118
                        KC539119
                        KC539120
                        KC539121
                        KC539122
                        KC539123
                        KC539124
                        KC539125
                        KC539126
                        KC539127
                        KC539128
                        KC539129
                        KC539130
                        KC539131
                        KC539132
                        KC539133
                        KC539134
                        KC539135
                        KC539136
                        KC814205
                        KC814206
                        KC814207
                        KC814208
                        KC814209
                        KC814210
                        KC814211
                        KC814212
                        KC814213
                        KC814214
                        KC892155
                        KC892157
                        KC892199
                        KC892201
                        KC892204
                        KC892215
                        KC892228
                        KC892235
                        KC892238
                        KC892241
                        KC892242
                        KC892247
                        KC892299
                        KC892449
                        KC892487
                        KC892490
                        KC892520
                        KC892524
                        KC892525
                        KC892526
                        KC892527
                        KC892528
                        KC892529
                        KC892530
                        KC892532
                        KC892533
                        KC892534
                        KC892535
                        KC892536
                        KC892537
                        KC892538
                        KC892539
                        KC892540
                        KC892541
                        KC892542
                        KC892544
                        KC892545
                        KC892546
                        KC892547
                        KC892548
                        KC892556
                        KC892560
                        KC892585
                        KC892590
                        KC892599
                        KC892605
                        KC892607
                        KC892613
                        KC892614
                        KC892658
                        KC892659
                        KC892660
                        KC892661
                        KC892662
                        KC892663
                        KC892664
                        KC892665
                        KC892666
                        KC892668
                        KC892682
                        KC892688
                        KC892730
                        KC892736
                        KC892747
                        KC892772
                        KC892786
                        KC892787
                        KC892859
                        KC892887
                        KC892930
                        KC892939
                        KC892958
                        KC893039
                        KC893061
                        KC893062
                        KC893067
                        KC893069
                        KC893070
                        KC893071
                        KC893120
                        KC893124
                        KC893127
                        KC893129
                        KC893130
                        KC893131
                        KC893133
                        KC893136
                        KC893137
                        KC893138
                        KC893139
                        KC893140
                        KC893142
                        KC893143
                        KC893144
                        KC893145
                        KC893147
                        KC893148
                        KC893149
                        KC893150
                        KC893151
                        KC893152
                        KC893153
                        KC893154
                        KC893155
                        KC893156
                        KC893157
                        KC893158
                        KC893159
                        KC893162
                        KC893165
                        KC893167
                        KC914952
                        KC914953
                        KC914954
                        KC914955
                        KC914956
                        KC914957
                        KC915008
                        KC915009
                        KC915010
                        KC999473
                        KC999474
                        KC999475
                        KC999476
                        KC999477
                        KF034876
                        KF034877
                        KF034878
                        KF034879
                        KF034880
                        KF034881
                        KF034882
                        KF034883
                        KF041839
                        KF041841
                        KF041843
                        KF041844
                        KF041845
                        KF041846
                        KF041847
                        KF041848
                        KF041849
                        KF041850
                        KF041851
                        KF041852
                        KF041853
                        KF041854
                        KF041855
                        KF041856
                        KF041857
                        KF041858
                        KF041859
                        KF041860
                        KF041861
                        KF041862
                        KF041863
                        KF041864
                        KF041865
                        KF041866
                        KF041918
                        KF041921
                        KF041922
                        KF041923
                        KF041924
                        KF041925
                        KF041926
                        KF041927
                        KF041928
                        KF041929
                        KF041930
                        KF041931
                        KF041932
                        KF041933
                        KF041934
                        KF041935
                        KF041936
                        KF041937
                        KF041938
                        KF041939
                        KF041940
                        KF041941
                        KF142471
                        KF142476
                        KF142477
                        KF199854
                        KF199856
                        KF199858
                        KF199859
                        KF432080
                        KF432081
                        KF432082
                        KF432083
                        KF432084
                        KF432085
                        KF432086
                        KF432087
                        KF451872
                        KF451873
                        KF451874
                        KF451875
                        KF451876
                        KF451877
                        KF451878
                        KF451879
                        KF451880
                        KF451881
                        KF451882
                        KF451883
                        KF451884
                        KF451885
                        KF451886
                        KF451887
                        KF451888
                        KF451889
                        KF451890
                        KF451891
                        KF451892
                        KF451893
                        KF451894
                        KF451895
                        KF451896
                        KF471234
                        KF471235
                        KF471236
                        KF471237
                        KF471238
                        KF471239
                        KF471240
                        KF471241
                        KF471242
                        KF471243
                        KF471244
                        KF471245
                        KF471246
                        KF471247
                        KF471298
                        KF471299
                        KF471300
                        KF471301
                        KF471302
                        KF471303
                        KF471304
                        KF471305
                        KF471306
                        KF471307
                        KF471308
                        KF471309
                        KF471310
                        KF471311
                        KF495607
                        KF495608
                        KF495609
                        KF495610
                        KF495611
                        KF495612
                        KF495613
                        KF495614
                        KF495615
                        KF495616
                        KF495617
                        KF495618
                        KF495619
                        KF495620
                        KF495621
                        KF495622
                        KF495623
                        KF495624
                        KF495625
                        KF495626
                        KF495627
                        KF495628
                        KF668195
                        KF668196
                        KF668197
                        KF668198
                        KF668199
                        KF668200
                        KF668201
                        KF668202
                        KF668203
                        KF668204
                        KF668205
                        KF668206
                        KF668207
                        KF668220
                        KF668221
                        KF668222
                        KF668223
                        KF668224
                        KF668225
                        KF668226
                        KF668227
                        KF668228
                        KF668229
                        KF668230
                        KF668231
                        KF668232
                        KF685746
                        KF685747
                        KF761472
                        KF761473
                        KF761474
                        KF761475
                        KF761476
                        KF761477
                        KF761478
                        KF761479
                        KF761480
                        KF761481
                        KF761482
                        KF761483
                        KF761484
                        KF761485
                        KF761486
                        KF761487
                        KF761488
                        KF761489
                        KF761490
                        KF761491
                        KF761492
                        KF761493
                        KF761494
                        KF761495
                        KF761496
                        KF761497
                        KF761498
                        KF761499
                        KF761500
                        KF761501
                        KF761502
                        KF761503
                        KF761504
                        KF761505
                        KF761506
                        KF761507
                        KF761508
                        KF761509
                        KF761510
                        KF761511
                        KF761512
                        KF761513
                        KF789532
                        KF789533
                        KF789534
                        KF789535
                        KF789536
                        KF789537
                        KF789538
                        KF789539
                        KF789540
                        KF789541
                        KF789542
                        KF789543
                        KF789544
                        KF789545
                        KF789546
                        KF789547
                        KF789548
                        KF789549
                        KF789550
                        KF789551
                        KF789552
                        KF789553
                        KF789554
                        KF789555
                        KF789556
                        KF789557
                        KF789558
                        KF789559
                        KF789560
                        KF789561
                        KF789562
                        KF789563
                        KF789564
                        KF789565
                        KF789566
                        KF789567
                        KF789568
                        KF789569
                        KF789570
                        KF789571
                        KF789572
                        KF789573
                        KF789574
                        KF789575
                        KF789576
                        KF789577
                        KF789578
                        KF789579
                        KF789580
                        KF789581
                        KF789582
                        KF789583
                        KF789584
                        KF789585
                        KF789586
                        KF789587
                        KF789588
                        KF789589
                        KF789590
                        KF789591
                        KF789592
                        KF789593
                        KF789594
                        KF789595
                        KF789596
                        KF789597
                        KF789598
                        KF789599
                        KF789600
                        KF789601
                        KF789602
                        KF789603
                        KF789604
                        KF789605
                        KF789606
                        KF789607
                        KF789608
                        KF789609
                        KF789610
                        KF789611
                        KF789612
                        KF789613
                        KF789614
                        KF789615
                        KF789616
                        KF789617
                        KF789618
                        KF789619
                        KF789620
                        KF789621
                        KF789622
                        KF789623
                        KF789624
                        KF789625
                        KF789626
                        KF789627
                        KF789628
                        KF789629
                        KF789630
                        KF789631
                        KF789632
                        KF789633
                        KF789634
                        KF789635
                        KF789636
                        KF789637
                        KF789638
                        KF789639
                        KF789640
                        KF789641
                        KF789642
                        KF789643
                        KF789644
                        KF789645
                        KF789646
                        KF789647
                        KF789648
                        KF789649
                        KF789650
                        KF789651
                        KF789652
                        KF789653
                        KF789654
                        KF789655
                        KF789656
                        KF789657
                        KF789658
                        KF789659
                        KF789660
                        KF789661
                        KF789662
                        KF789663
                        KF789664
                        KF789665
                        KF789666
                        KF789667
                        KF789668
                        KF789669
                        KF789670
                        KF789671
                        KF789672
                        KF789673
                        KF789674
                        KF789675
                        KF789676
                        KF789677
                        KF789678
                        KF789679
                        KF789680
                        KF789681
                        KF789682
                        KF789683
                        KF789684
                        KF789685
                        KF789686
                        KF789687
                        KF789688
                        KF789689
                        KF789690
                        KF789691
                        KF789692
                        KF789693
                        KF789699
                        KF789701
                        KF789702
                        KF789703
                        KF789704
                        KF789705
                        KF789706
                        KF789707
                        KF789708
                        KF789709
                        KF789710
                        KF789711
                        KF789712
                        KF789713
                        KF789714
                        KF789715
                        KF789716
                        KF789717
                        KF789718
                        KF789719
                        KF789720
                        KF789721
                        KF789722
                        KF789723
                        KF789724
                        KF789725
                        KF789726
                        KF789727
                        KF789728
                        KF789729
                        KF789730
                        KF789731
                        KF789732
                        KF789733
                        KF789734
                        KF789735
                        KF789736
                        KF789737
                        KF789738
                        KF789739
                        KF789740
                        KF789741
                        KF789742
                        KF789743
                        KF789744
                        KF789745
                        KF789746
                        KF789747
                        KF789748
                        KF789749
                        KF789750
                        KF789751
                        KF789752
                        KF789753
                        KF789754
                        KF789755
                        KF789756
                        KF789757
                        KF789758
                        KF789759
                        KF789760
                        KF789761
                        KF789762
                        KF789763
                        KF789764
                        KF789765
                        KF789766
                        KF789767
                        KF789768
                        KF789769
                        KF789770
                        KF789771
                        KF789772
                        KF789773
                        KF789774
                        KF789775
                        KF789776
                        KF789777
                        KF789778
                        KF789779
                        KF789780
                        KF789781
                        KF789782
                        KF789783
                        KF789784
                        KF789785
                        KF789786
                        KF789787
                        KF789788
                        KF789789
                        KF789790
                        KF789791
                        KF789792
                        KF789793
                        KF789794
                        KF789795
                        KF789796
                        KF789797
                        KF789798
                        KF789799
                        KF789800
                        KF789801
                        KF789802
                        KF789803
                        KF789804
                        KF789805
                        KF789806
                        KF789807
                        KF789808
                        KF789809
                        KF789810
                        KF789811
                        KF789812
                        KF789813
                        KF789814
                        KF789815
                        KF789816
                        KF789817
                        KF789818
                        KF789819
                        KF789820
                        KF789821
                        KF789822
                        KF789823
                        KF789824
                        KF789825
                        KF789826
                        KF789827
                        KF789828
                        KF789829
                        KF789830
                        KF789831
                        KF789832
                        KF789833
                        KF789834
                        KF789835
                        KF789836
                        KF789837
                        KF789838
                        KF789839
                        KF789840
                        KF789841
                        KF789842
                        KF789843
                        KF789844
                        KF789845
                        KF789846
                        KF789847
                        KF789848
                        KF789849
                        KF789850
                        KF789851
                        KF789852
                        KF789853
                        KF789854
                        KF789855
                        KF789856
                        KF789857
                        KF789858
                        KF789859
                        KF789860
                        KF789861
                        KF789862
                        KF789863
                        KF789864
                        KF789865
                        KF789866
                        KF789867
                        KF789868
                        KF789869
                        KF789870
                        KF789871
                        KF789872
                        KF789873
                        KF789874
                        KF789875
                        KF789876
                        KF789877
                        KF789878
                        KF789879
                        KF789880
                        KF789881
                        KF789882
                        KF789883
                        KF789884
                        KF789885
                        KF789886
                        KF789887
                        KF789888
                        KF789889
                        KF789890
                        KF789891
                        KF789892
                        KF789893
                        KF789894
                        KF789895
                        KF789896
                        KF789897
                        KF789898
                        KF789899
                        KF789900
                        KF789901
                        KF789902
                        KF789903
                        KF789904
                        KF789905
                        KF789906
                        KF789907
                        KF789909
                        KF789910
                        KF789911
                        KF789912
                        KF789913
                        KF789914
                        KF789915
                        KF789916
                        KF789917
                        KF789918
                        KF789919
                        KF789920
                        KF789921
                        KF789922
                        KF789923
                        KF789924
                        KF789925
                        KF789926
                        KF789927
                        KF789928
                        KF789929
                        KF789930
                        KF789931
                        KF789932
                        KF789933
                        KF789934
                        KF789935
                        KF789936
                        KF789937
                        KF789938
                        KF789939
                        KF789941
                        KF789942
                        KF789943
                        KF789944
                        KF789945
                        KF789946
                        KF789947
                        KF789948
                        KF789949
                        KF789950
                        KF789951
                        KF789952
                        KF789953
                        KF789954
                        KF789955
                        KF789956
                        KF789957
                        KF789958
                        KF789959
                        KF789960
                        KF789961
                        KF789962
                        KF789963
                        KF789964
                        KF789965
                        KF789966
                        KF789967
                        KF789968
                        KF789969
                        KF789970
                        KF789971
                        KF789972
                        KF789973
                        KF789974
                        KF789975
                        KF789976
                        KF789977
                        KF789978
                        KF789979
                        KF789980
                        KF789981
                        KF789982
                        KF789983
                        KF789984
                        KF789985
                        KF789986
                        KF789987
                        KF789988
                        KF789989
                        KF789990
                        KF789991
                        KF789992
                        KF789993
                        KF789994
                        KF789995
                        KF789996
                        KF789997
                        KF789998
                        KF789999
                        KF790000
                        KF790001
                        KF790002
                        KF790003
                        KF790004
                        KF790005
                        KF790006
                        KF790007
                        KF790008
                        KF790009
                        KF790010
                        KF790011
                        KF790012
                        KF790013
                        KF790014
                        KF790015
                        KF790016
                        KF790017
                        KF790018
                        KF790019
                        KF790020
                        KF790021
                        KF790022
                        KF790023
                        KF790024
                        KF790025
                        KF790026
                        KF790027
                        KF790028
                        KF790029
                        KF790030
                        KF790031
                        KF790032
                        KF790033
                        KF790034
                        KF790035
                        KF790036
                        KF790037
                        KF790038
                        KF790039
                        KF790040
                        KF790041
                        KF790042
                        KF790043
                        KF790044
                        KF790045
                        KF790046
                        KF790047
                        KF790048
                        KF790049
                        KF790051
                        KF790052
                        KF790053
                        KF790054
                        KF790055
                        KF790056
                        KF790057
                        KF790058
                        KF790059
                        KF790060
                        KF790061
                        KF790062
                        KF790063
                        KF790064
                        KF790065
                        KF790066
                        KF790067
                        KF790068
                        KF790069
                        KF790070
                        KF790071
                        KF790072
                        KF790073
                        KF790074
                        KF790075
                        KF790076
                        KF790077
                        KF790078
                        KF790079
                        KF790080
                        KF790081
                        KF790082
                        KF790083
                        KF790084
                        KF790085
                        KF790086
                        KF790087
                        KF790089
                        KF790091
                        KF790092
                        KF790093
                        KF790094
                        KF790095
                        KF790096
                        KF790097
                        KF790098
                        KF790099
                        KF790100
                        KF790101
                        KF790102
                        KF790103
                        KF790104
                        KF790105
                        KF790106
                        KF790107
                        KF790108
                        KF790109
                        KF790110
                        KF790111
                        KF790112
                        KF790113
                        KF790114
                        KF790115
                        KF790116
                        KF790117
                        KF790118
                        KF790119
                        KF790120
                        KF790121
                        KF790122
                        KF790123
                        KF790124
                        KF790125
                        KF790126
                        KF790127
                        KF790128
                        KF790129
                        KF790130
                        KF790131
                        KF790132
                        KF790133
                        KF790134
                        KF790135
                        KF790136
                        KF790137
                        KF790138
                        KF790139
                        KF790140
                        KF790141
                        KF790148
                        KF790149
                        KF790150
                        KF790151
                        KF790152
                        KF790153
                        KF790154
                        KF790155
                        KF790156
                        KF790157
                        KF790158
                        KF790159
                        KF790160
                        KF790161
                        KF790162
                        KF790163
                        KF790164
                        KF790165
                        KF790166
                        KF790167
                        KF790168
                        KF790169
                        KF790170
                        KF790171
                        KF790172
                        KF790173
                        KF790174
                        KF790175
                        KF790176
                        KF790177
                        KF790178
                        KF790179
                        KF790180
                        KF790181
                        KF790182
                        KF790183
                        KF790184
                        KF790185
                        KF790186
                        KF790187
                        KF790188
                        KF790189
                        KF790190
                        KF790191
                        KF790192
                        KF790193
                        KF790194
                        KF790195
                        KF790196
                        KF790197
                        KF790198
                        KF790199
                        KF790200
                        KF790201
                        KF790202
                        KF790203
                        KF790204
                        KF790205
                        KF790206
                        KF790207
                        KF790209
                        KF790210
                        KF790211
                        KF790212
                        KF790213
                        KF790214
                        KF790215
                        KF790216
                        KF790217
                        KF790218
                        KF790219
                        KF790220
                        KF790221
                        KF790222
                        KF790223
                        KF790224
                        KF790225
                        KF790226
                        KF790227
                        KF790228
                        KF790229
                        KF790230
                        KF790231
                        KF790232
                        KF790233
                        KF790234
                        KF790235
                        KF790236
                        KF790237
                        KF790238
                        KF790239
                        KF790240
                        KF790241
                        KF790242
                        KF790243
                        KF790244
                        KF790245
                        KF790246
                        KF790247
                        KF790248
                        KF790249
                        KF790250
                        KF790251
                        KF790252
                        KF790253
                        KF790254
                        KF790255
                        KF790256
                        KF790257
                        KF790258
                        KF790259
                        KF790260
                        KF790261
                        KF790262
                        KF790263
                        KF790264
                        KF790265
                        KF790266
                        KF790267
                        KF790268
                        KF790269
                        KF790270
                        KF790271
                        KF790272
                        KF790273
                        KF790274
                        KF790275
                        KF790276
                        KF790277
                        KF790278
                        KF790279
                        KF790280
                        KF790281
                        KF790282
                        KF790283
                        KF790284
                        KF790285
                        KF790286
                        KF790287
                        KF790288
                        KF790289
                        KF790290
                        KF790291
                        KF790292
                        KF790293
                        KF790294
                        KF790295
                        KF790296
                        KF790300
                        KF790301
                        KF790302
                        KF790303
                        KF790304
                        KF790305
                        KF790306
                        KF790307
                        KF790308
                        KF790309
                        KF790310
                        KF790311
                        KF790312
                        KF790313
                        KF790314
                        KF790315
                        KF790316
                        KF790317
                        KF790318
                        KF790319
                        KF790320
                        KF790321
                        KF790322
                        KF790323
                        KF790324
                        KF790325
                        KF790326
                        KF790327
                        KF790328
                        KF790329
                        KF790330
                        KF790331
                        KF790332
                        KF790333
                        KF790334
                        KF790335
                        KF790336
                        KF790337
                        KF790338
                        KF790339
                        KF790340
                        KF790341
                        KF790342
                        KF790343
                        KF790344
                        KF790345
                        KF790346
                        KF790347
                        KF790348
                        KF790349
                        KF790350
                        KF790351
                        KF790352
                        KF790353
                        KF790354
                        KF790356
                        KF790357
                        KF790358
                        KF790359
                        KF790360
                        KF790361
                        KF790362
                        KF790363
                        KF790364
                        KF790365
                        KF790366
                        KF790367
                        KF790368
                        KF790369
                        KF790370
                        KF790371
                        KF790372
                        KF790373
                        KF790374
                        KF790375
                        KF790376
                        KF790377
                        KF790378
                        KF790379
                        KF790381
                        KF790382
                        KF790383
                        KF790384
                        KF790385
                        KF790386
                        KF790387
                        KF790388
                        KF790389
                        KF790390
                        KF790391
                        KF790392
                        KF790393
                        KF790394
                        KF790395
                        KF790396
                        KF790397
                        KF790398
                        KF790399
                        KF790400
                        KF790401
                        KF790402
                        KF790403
                        KF790404
                        KF790405
                        KF790406
                        KF790407
                        KF790408
                        KF790409
                        KF790410
                        KF790411
                        KF790412
                        KF790413
                        KF790414
                        KF790415
                        KF790416
                        KF790417
                        KF790418
                        KF790419
                        KF790420
                        KF790421
                        KF790422
                        KF790423
                        KF790424
                        KF790425
                        KF790426
                        KF790428
                        KF790429
                        KF790430
                        KF790431
                        KF790432
                        KF790433
                        KF790434
                        KF790435
                        KF790436
                        KF790437
                        KF790438
                        KF790439
                        KF790440
                        KF790441
                        KF790442
                        KF790443
                        KF790444
                        KF790445
                        KF790446
                        KF790447
                        KF790448
                        KF790449
                        KF790450
                        KF790451
                        KF790452
                        KF790453
                        KF790454
                        KF790455
                        KF790456
                        KF790457
                        KF790458
                        KF790459
                        KF790460
                        KF790461
                        KF790462
                        KF790463
                        KF790464
                        KF790465
                        KF790466
                        KF790467
                        KF790468
                        KF790469
                        KF790470
                        KF790471
                        KF790472
                        KF790473
                        KF790474
                        KF790475
                        KF790476
                        KF790477
                        KF790478
                        KF790479
                        KF790480
                        KF790481
                        KF790482
                        KF790483
                        KF790484
                        KF790485
                        KF790486
                        KF790487
                        KF790488
                        KF790489
                        KF790490
                        KF790491
                        KF790492
                        KF790493
                        KF790494
                        KF790495
                        KF790496
                        KF790497
                        KF790498
                        KF790499
                        KF790500
                        KF790501
                        KF790502
                        KF790503
                        KF790504
                        KF790505
                        KF790506
                        KF790507
                        KF790508
                        KF790509
                        KF790510
                        KF790511
                        KF790512
                        KF790513
                        KF790514
                        KF790515
                        KF790516
                        KF790517
                        KF790518
                        KF790519
                        KF790520
                        KF790521
                        KF790522
                        KF790523
                        KF790524
                        KF790525
                        KF790526
                        KF790527
                        KF790528
                        KF790529
                        KF790530
                        KF790531
                        KF790532
                        KF790533
                        KF805633
                        KF805634
                        KF805635
                        KF805636
                        KF805637
                        KF805638
                        KF805639
                        KF805640
                        KF805641
                        KF805642
                        KF805643
                        KF805644
                        KF805645
                        KF805646
                        KF805647
                        KF805648
                        KF805649
                        KF805650
                        KF805651
                        KF805652
                        KF805653
                        KF805654
                        KF805655
                        KF805656
                        KF805657
                        KF805658
                        KF805659
                        KF805660
                        KF805661
                        KF805662
                        KF805663
                        KF805664
                        KF805665
                        KF805666
                        KF805667
                        KF805668
                        KF805669
                        KF805670
                        KF805671
                        KF805672
                        KF805673
                        KF805674
                        KF805675
                        KF805676
                        KF805677
                        KF805678
                        KF805679
                        KF805680
                        KF805681
                        KF805682
                        KF805683
                        KF805684
                        KF805685
                        KF805686
                        KF805687
                        KF805688
                        KF805689
                        KF805690
                        KF805691
                        KF805692
                        KF805693
                        KF805694
                        KF805695
                        KF805696
                        KF805697
                        KF805698
                        KF805699
                        KF805700
                        KF805701
                        KF805702
                        KF805703
                        KF805704
                        KF805705
                        KF805706
                        KF805707
                        KF805708
                        KF805709
                        KF805710
                        KF805711
                        KF805712
                        KF850641
                        KF850642
                        KF850644
                        KF850645
                        KF850646
                        KF850648
                        KF850649
                        KF850650
                        KF850651
                        KF850652
                        KF850653
                        KF850654
                        KF850655
                        KF850656
                        KF850658
                        KF850659
                        KF850660
                        KF850661
                        KF850662
                        KF850663
                        KF850664
                        KF850666
                        KF850670
                        KF850671
                        KF850674
                        KF850675
                        KF850676
                        KF850677
                        KF850679
                        KF886297
                        KF886301
                        KF886303
                        KF886305
                        KF886306
                        KF886309
                        KF886310
                        KF886312
                        KF886315
                        KF886321
                        KF886322
                        KF886323
                        KF886324
                        KF886332
                        KF886335
                        KF886337
                        KF886340
                        KF886341
                        KF886343
                        KF886344
                        KF886347
                        KF886348
                        KF886349
                        KF886350
                        KF886351
                        KF886352
                        KF886353
                        KF886354
                        KF886355
                        KF886356
                        KF886357
                        KF886358
                        KF886359
                        KF886360
                        KF886361
                        KF886362
                        KF886363
                        KF886364
                        KF928614
                        KF928615
                        KF928616
                        KF928617
                        KF928618
                        KF928619
                        KF928620
                        KF928621
                        KF928622
                        KF928623
                        KF928624
                        KF928625
                        KF928626
                        KF928627
                        KF928628
                        KF928629
                        KF928630
                        KF928631
                        KF928632
                        KF928633
                        KF928640
                        KF928641
                        KF928642
                        KF928643
                        KJ138416
                        KJ138417
                        KJ196075
                        KJ196076
                        KJ196077
                        KJ196078
                        KJ196079
                        KJ196080
                        KJ206241
                        KJ206242
                        KJ206243
                        KJ206244
                        KJ206245
                        KJ206246
                        KJ206247
                        KJ206248
                        KJ206249
                        KJ206250
                        KJ206251
                        KJ206252
                        KJ206253
                        KJ206254
                        KJ206255
                        KJ206256
                        KJ206257
                        KJ206258
                        KJ206259
                        KJ206260
                        KJ206261
                        KJ206262
                        KJ206263
                        KJ206264
                        KJ206265
                        KJ206266
                        KJ206267
                        KJ206268
                        KJ206269
                        KJ528271
                        KJ540627
                        KJ561735
                        KJ561736
                        KJ561737
                        KJ561738
                        KJ561739
                        KJ561740
                        KJ561741
                        KJ561742
                        KJ561751
                        KJ561752
                        KJ561753
                        KJ561754
                        KJ561755
                        KJ561756
                        KJ561757
                        KJ561758
                        -----------------------------------
                        xw01.gif : 2200 H3N2 genomes from the 2007ff-strain
                        genbank as of Aug.2014
                        Attached Files
                        I'm interested in expert panflu damage estimates
                        my current links: [url]http://bit.ly/hFI7H[/url] ILI-charts: [url]http://bit.ly/CcRgT[/url]

                        Comment


                        • #27
                          Re: H3n2

                          WHO vaccine clades, 2014

                          NZ-overview with phylotrees etc.
                          https://surv.esr.cri.nz/PDF_surveill...FluVac2015.pdf


                          (32g12f1.c2,10-37) = Egypt/Iowa+Q49R,S61N,T64I,N161S,A214S,V239I,N294K,N328S
                          vaccine=Tx50 : (32..)+T144N,G202V,S214P,S235F
                          [Switz...] = 3C.3a : (32..)+T144A,A154S,R158G,F175S,N241D,K342R

                          substract 16 to get WHO-locations



                          Code:
                                                                                     000000000000000000000000000000000000000000000000000000
                                                                                     000000000000000111111111111111222222222222223333333555
                                                                                     011123446666777013445566777788000123344557990224467002
                                                                                     468944791469348808044801345679258485916287468782337351
                                                                                     ------------------------------------------------------
                                                                                     IAKLNHNQSTEDQIEKYNSTARNNLNFKNQGKIAASVNIIIRNEKQNKQVRDDV
                          >2007/02/06,14278,AUS,A/Brisbane/10/07                     .T.......................K...K.N..T...............I...
                          >Index/USA-2007                                            .........................K...K.N..T...............I...
                          >Index/Brisbane-like/2007                                  .........................K...K.NV.T...............I...
                          >Index/32g12f1.c2,55-62                                    ..E.D..R...N....H.................T...V....A..........
                          >Index/H3N3-2011-reassortedEI/2011(H3N2)                   ...........N....H.....................V....A..........
                          >Index/2009/Egypt-Iowa+NA,2009//                           ......................................................
                          >Index/2009/Egypt/Iowa                                     ......................................................
                          >Index/H3N2-2011-normalEI/2011(H3N2)                       .........A..H..R..............................S..M....
                          >A/Czech Republic/121/2012,2012/03/06,Czech Republic       .......RNIK.......N.........D....S..I.....K...S.......
                          >Index/32g12f1.c2,38-41                                    .......RNI........N....S.........S..I.....K.R.S.......
                          >Index/32g12f1.c2,10-37                                    .......RNI.............S.........S..I.....K...S.......
                          >KM064114,A/Texas/17/2014,2014/05/05,USA,H3N2,Human,4      .....Y.RNI.........A.G.S.........S..I.....K...S..K....
                          >KM852940,A/Utah/09/2014,2014/05/07,USA,H3N2,Human,4       .......RNI.........A.G.S.........S..I...M.K...S.EK....
                          >KM852915,A/Kansas/06/2014,2014/05/05,USA,H3N2,Human,4     ......DRNI.......D.A.G.SS.......TS..I.....K...S..M....
                          >KM852967,A/Minnesota/14/2014,2014/07/10,USA,H3N2,Human,4  .......RNI.........ASG.S..-......S..ID.V..K...SR......
                          >KM853009,A/New Mexico/16/2014,2014/05/15,USA,H3N2,Human,4 .......RNI..-......ASG.S..S......S..ID.V..K...SR.....I
                          >KM852961,A/Alaska/29/2014,2014/07/18,USA,H3N2,Human,4     T......RNI.........DSG.S..S......S..ID....K...SR......
                          >KM852972,A/Nevada/11/2014,2014/05/28,USA,H3N2,Human,4     .......RNI...V.....ASG.S..S......S..ID....K...SR......
                          >KM852975,A/Alaska/27/2014,2014/05/13,USA,H3N2,Human,4     .......RNI.........ASG.S..S......S..ID....K...SR......
                          >KM852977,A/Alaska/26/2014,2014/05/22,USA,H3N2,Human,4     .......RNI.........ASG.S..S......S..ID....K...SR......
                          >KM852971,A/Wisconsin/11/2014,2014/05/22,USA,H3N2,Human,4  ...I...RNI......H..ASG.S..S......S..ID....K...S.......
                          >KM852976,A/Iowa/09/2014,2014/05/23,USA,H3N2,Human,4       ...I...RNI...........GSS.-Y-.....S..ID....K..HS.....N.
                          >KM852877,A/Alaska/34/2014,2014/07/05,USA,H3N2,Human,4     ...I...RNI............SS..YT.....S..ID....K..HS.....N.
                          >KM853006,A/Iowa/08/2014,2014/05/08,USA,H3N2,Human,4       ...I...RNI......H.....SS..YT.....S..ID....K..HS.....N.
                          >KM852959,A/Washington/12/2014,2014/05/02,USA,H3N2,Human,4 ...I...RNI............SS..YT.....S..ID....K..HS.....N.
                          >KM852880,A/Texas/36/2014,2014/06/13,USA,H3N2,Human,4      ...I...RNI............SS..YT.....S..ID....K..HS.....N.
                          >KM852939,A/Iowa/07/2014,2014/05/05,USA,H3N2,Human,4       ...I...RNI............SS..YT.....S..ID..M.K..HS.....N.
                          >KM853004,A/Wisconsin/14/2014,2014/06/29,USA,H3N2,Human,4  ...I...RNI............SS..YT.....S..ID....K..HS.....N.
                          >KM853010,A/Washington/13/2014,2014/05/07,USA,H3N2,Human,4 ...I...RNI............SS..YT.....S..ID....K..HS.....N.
                          >KM853007,A/Utah/08/2014,2014/05/01,USA,H3N2,Human,4       ...I...RNI.N..........SS...T.....S..ID....K..HS.....N.
                          >KM852892,A/Utah/10/2014,2014/05/27,USA,H3N2,Human,4       ...I...RNI.N..........SS.........S..ID....K..HS.....N.
                          >Index/32g12f1.c2,42-53                                    ......................DS..........S.I....Q.........N..
                          >Index/Perth-like/2009                                     ..............K.......K...........T...................
                          >A/Texas/50/2012,2012//,USA,H3N2,Human                     .......RNI.........N..........V..P.FI.....K...S.......
                                                                                     000000000000000000000000000000000000000000000000000000
                                                                                     000000000000000111111111111111222222222222223333333555
                                                                                     011123446666777013445566777788000123344557990224467002
                                                                                     468944791469348808044801345679258485916287468782337351
                                                                                     ------------------------------------------------------
                                                                                     IAKLNHNQSTEDQIEKYNSTARNNLNFKNQGKIAASVNIIIRNEKQNKQVRDDV
                          Attached Files
                          I'm interested in expert panflu damage estimates
                          my current links: [url]http://bit.ly/hFI7H[/url] ILI-charts: [url]http://bit.ly/CcRgT[/url]

                          Comment

                          Working...
                          X