Announcement

Collapse
No announcement yet.

Tamiflu Resistant Pandemic H1N1 Sequence from Hunan China Released

Collapse
X
  • Filter
  • Time
  • Show
Clear All
new posts

  • Tamiflu Resistant Pandemic H1N1 Sequence from Hunan China Released

    Sequence from Hunan, China with H274Y was just released at Genbank.

  • #2
    Re: Tamiflu Resisatant Pandemic H1N1 Sequence from Hunan China Released

    LOCUS GQ463202 1410 bp cRNA linear VRL 07-AUG-2009
    DEFINITION Influenza A virus (A/Hunan/SWL3/2009(H1N1)) segment 6 neuraminidase
    (NA) gene, complete cds.
    ACCESSION GQ463202
    VERSION GQ463202.1 GI:255675082
    DBLINK Project:37813
    KEYWORDS .
    SOURCE Influenza A virus (A/Hunan/SWL3/2009(H1N1))
    ORGANISM Influenza A virus (A/Hunan/SWL3/2009(H1N1))
    Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
    Influenzavirus A.
    REFERENCE 1 (bases 1 to 1410)
    AUTHORS Li,Z., Li,X., Zhao,X., Cheng,Y., Tan,M., Li,X., Yang,L., Zou,S.,
    Wen,L., Wang,D., Li,D. and Shu,Y.
    TITLE Genetic characteristic of novel A (H1N1) in China
    JOURNAL Unpublished
    REFERENCE 2 (bases 1 to 1410)
    AUTHORS Li,Z., Li,X., Zhao,X., Cheng,Y., Tan,M., Li,X., Yang,L., Zou,S.,
    Wen,L., Wang,D., Li,D. and Shu,Y.
    TITLE Direct Submission
    JOURNAL Submitted (07-AUG-2009) Chinese National Influenza Center, National
    Institute for Viral Disease Control and Prevention, China CDC IVDC,
    100 Yingxin Jie Xuanwu Qu, Beijing 100052, China
    COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
    outbreak of 2009.
    GenBank Accession Numbers GQ463197-GQ463204 represent sequences
    from the 8 segments of Influenza A virus (A/Hunan/SWL3/2009(H1N1)).

    Swine influenza A (H1N1) virus isolated during human swine flu
    outbreak of 2009.
    FEATURES Location/Qualifiers
    source 1..1410
    /organism="Influenza A virus (A/Hunan/SWL3/2009(H1N1))"
    /mol_type="viral cRNA"
    /strain="A/Hunan/SWL3/2009"
    /serotype="H1N1"
    /host="Homo sapiens; gender F; age 63"
    /db_xref="taxon:665003"
    /segment="6"
    /country="China"
    /collection_date="13-Jun-2009"
    /note="lineage: swl
    A/Hunan/SWL3/2009(H1N1)v"
    gene 1..1410
    /gene="NA"
    CDS 1..1410
    /gene="NA"
    /codon_start=1
    /product="neuraminidase"
    /protein_id="ACU27043.1"
    /db_xref="GI:255675083"
    /translation="MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHS IQLGNQN
    QIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPV SGWAIYSK
    DNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDR SPYRTLMS
    CPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNG IITDTIKS
    WRNNILRTQESECACVNGSCFTVMTDGPSDGQASYKIFRIEKGKIVKSVE MNAPNYYY
    EECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNP RPNDKTGS
    CGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTD NNFSIKQD
    IVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSS ISFCGVNS
    DTVGWSWPDGAELPFTIDK"
    ORIGIN
    1 atgaatccaa accaaaagat aataaccatt ggttcggtct gtatgacaat tggaatggct
    61 aacttaatat tacaaattgg aaacataatc tcaatatgga ttagccactc aattcaactt
    121 gggaatcaaa atcagattga aacatgcaat caaagcgtca ttacttatga aaacaacact
    181 tgggtaaatc agacatatgt taacatcagc aacaccaact ttgctgctgg acagtcagtg
    241 gtttccgtga aattagcggg caattcctct ctctgccctg ttagtggatg ggctatatac
    301 agtaaagaca acagtataag aatcggttcc aagggggatg tgtttgtcat aagggaacca
    361 ttcatatcat gctccccctt ggaatgcaga accttcttct tgactcaagg ggccttgcta
    421 aatgacaaac attccaatgg aaccattaaa gacaggagcc catatcgaac cctaatgagc
    481 tgtcctattg gtgaagttcc ctctccatac aactcaagat ttgagtcagt cgcttggtca
    541 gcaagtgctt gtcatgatgg catcaattgg ctaacaattg gaatttctgg cccagacaat
    601 ggggcagtgg ctgtgttaaa gtacaacggc ataataacag acactatcaa gagttggaga
    661 aacaatatat tgagaacaca agagtctgaa tgtgcatgtg taaatggttc ttgctttact
    721 gtaatgaccg atggaccaag tgatggacag gcctcataca agatcttcag aatagaaaag
    781 ggaaagatag tcaaatcagt cgaaatgaat gcccctaatt attactatga ggaatgctcc
    841 tgttatcctg attctagtga aatcacatgt gtgtgcaggg ataactggca tggctcgaat
    901 cgaccgtggg tgtctttcaa ccagaatctg gaatatcaga taggatacat atgtagtggg
    961 attttcggag acaatccacg ccctaatgat aagacaggca gttgtggtcc agtatcgtct
    1021 aatggagcaa atggagtaaa aggattttca ttcaaatacg gcaatggtgt ttggataggg
    1081 agaactaaaa gcattagttc aagaaacggt tttgagatga tttgggatcc gaacggatgg
    1141 actgggacag acaataactt ctcaataaag caagatatcg taggaataaa tgagtggtca
    1201 ggatatagcg ggagttttgt tcagcatcca gaactaacag ggctggattg tataagacct
    1261 tgcttctggg ttgaactaat cagagggcga cccaaagaga acacaatctg gactagcggg
    1321 agcagcatat ccttttgtgg tgtaaacagt gacactgtgg gttggtcttg gccagacggt
    1381 gctgagttgc catttaccat tgacaagtaa

    Comment


    • #3
      Re: Tamiflu Resisatant Pandemic H1N1 Sequence from Hunan China Released

      This sample ws collect June 13, about the same time as the samples from Denmark and Japan.

      Comment


      • #4
        Re: Tamiflu Resisatant Pandemic H1N1 Sequence from Hunan China Released

        Is there enough info to know if this sample was acquired prior to any anti-viral treatment?

        .
        "The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation

        Comment


        • #5
          Re: Tamiflu Resisatant Pandemic H1N1 Sequence from Hunan China Released

          H274Y travel log

          gb|CY043352.1| Influenza A virus (A/Denmark/528/2009(H1N1)) s... 36.2 0.73
          gb|GQ397279.1| Influenza A virus (A/Yamaguchi/22/2009(H1N1)) ... 36.2 0.73
          gb|GQ365445.1| Influenza A virus (A/Osaka/180/2009(H1N1)) seg... 36.2 0.73
          gb|GQ351316.1| Influenza A virus (A/Hong Kong/2369/2009(H1N1)... 36.2 0.73
          gb|EU567011.1| Influenza A virus (A/Indiana/01/2008(H1N1)) se... 36.2 0.73
          gb|DQ493078.1| Influenza A virus (A/Vietnam/CL2009/2005(H5N1)... 36.2 0.73
          gb|DQ250165.1| Influenza A virus (A/Vietnam/CL2009/2005(H5N1)... 36.2 0.73

          Comment


          • #6
            Re: Tamiflu Resisatant Pandemic H1N1 Sequence from Hunan China Released

            NA travel log

            gb|GQ409638.1| Influenza A virus (A/Athens/1079/2009(H1N1)) s... 38.2 0.19
            gb|GQ402239.1| Influenza A virus (A/Canada-QC/RV1954/2009(H1N... 38.2 0.19
            gb|GQ377036.1| Influenza A virus (A/Illinois/02/2009(H1N1)) s... 38.2 0.19
            gb|GQ377033.1| Influenza A virus (A/Alaska/04/2009(H1N1)) seg... 38.2 0.19
            gb|GQ367490.1| Influenza A virus (A/Sao Paulo/2303/2009(H1N1)... 38.2 0.19
            gb|GQ365457.1| Influenza A virus (A/Utsunomiya/2/2009(H1N1)) ... 38.2 0.19
            gb|GQ290107.1| Influenza A virus (A/Beijing/502/2009(H1N1)) s... 38.2 0.19
            gb|GQ338415.1| Influenza A virus (A/Wisconsin/07/2009(H1N1)) ... 38.2 0.19
            gb|GQ338362.1| Influenza A virus (A/Wisconsin/12/2009(H1N1)) ... 38.2 0.19
            gb|GQ334357.1| Influenza A virus (A/Utsunomiya/1/2009(H1N1)) ... 38.2 0.19
            gb|GQ323572.1| Influenza A virus (A/Wisconsin/10/2009(H1N1)) ... 38.2 0.19
            gb|GQ323570.1| Influenza A virus (A/Louisiana/03/2009(H1N1)) ... 38.2 0.19
            gb|GQ323548.1| Influenza A virus (A/Wisconsin/11/2009(H1N1)) ... 38.2 0.19
            gb|GQ323472.1| Influenza A virus (A/Louisiana/05/2009(H1N1)) ... 38.2 0.19
            gb|GQ292936.1| Influenza A virus (A/Mexico City/75/2009(H1N1)... 38.2 0.19
            gb|GQ292933.1| Influenza A virus (A/Mexico City/70/2009(H1N1)... 38.2 0.19
            gb|GQ292913.1| Influenza A virus (A/Mexico City/47/2009(H1N1)... 38.2 0.19
            gb|GQ292889.1| Influenza A virus (A/Mexico City/15/2009(H1N1)... 38.2 0.19
            gb|GQ292887.1| Influenza A virus (A/Mexico City/13/2009(H1N1)... 38.2 0.19
            gb|GQ292885.1| Influenza A virus (A/Mexico City/11/2009(H1N1)... 38.2 0.19
            gb|GQ283487.1| Influenza A virus (A/Finland/554/2009(H1N1)) s... 38.2 0.19
            gb|GQ223415.2| Influenza A virus (A/Beijing/501/2009(H1N1)) s... 38.2 0.19
            gb|GQ225383.1| Influenza A virus (A/Beijing/3/2009(H1N1)) seg... 38.2 0.19
            gb|GQ455034.1| Influenza A virus (A/Nanjing/2/2009(H1N1)) seg... 36.2 0.73
            gb|GQ457516.1| Influenza A virus (A/California/27/2009(H1N1))... 36.2 0.73

            Comment


            • #7
              Re: Tamiflu Resisatant Pandemic H1N1 Sequence from Hunan China Released

              Originally posted by AlaskaDenise View Post
              Is there enough info to know if this sample was acquired prior to any anti-viral treatment?

              .
              The characterization doesn't give any clues but the NA sequence has a polymorphism not seen in any other sequences with H274Y, indicating this is H274Y is appended onto yet another pandemic H1N1 genetic background. Thus, all released sequences with H274Y have distingusihing polymorphisms in N1, HA, or both, suggesting all are independent introductions.

              Comment


              • #8
                Re: Tamiflu Resisatant Pandemic H1N1 Sequence from Hunan China Released

                Originally posted by niman View Post
                The characterization doesn't give any clues but the NA sequence has a polymorphism not seen in any other sequences with H274Y, indicating this is H274Y is appended onto yet another pandemic H1N1 genetic background. Thus, all released sequences with H274Y have distingusihing polymorphisms in N1, HA, or both, suggesting all are independent introductions.
                Yea, Hunan is more like Beijing/3. Has T206S in HA like the Osaka isolate.

                All other Tamiflu resistant isolates have the S206T (Cancun-like) change.

                However, at the amino acid level, Hunan has no distinguishing characteristics.

                Comment


                • #9
                  Re: Tamiflu Resistant Pandemic H1N1 Sequence from Hunan China Released

                  <a rel="nofollow" href="http://www.recombinomics.com/News/08080901/H274Y_WW_Spread.html">Commentary</a>

                  Comment


                  • #10
                    Re: Tamiflu Resistant Pandemic H1N1 Sequence from Hunan China Released

                    Originally posted by niman View Post
                    <a rel="nofollow" href="http://www.recombinomics.com/News/08080901/H274Y_WW_Spread.html">Commentary</a>
                    Commentary


                    Global Spread of Tamiflu Resistant Pandemic H1N1
                    Recombinomics Commentary 20:35
                    August 8, 2009

                    The release of a full set of sequences from a patient in Hunan, China raises concerns that oseltamivir resistance is widespread and circulating at much higher frequencies than indicated by the eight detail isolates. The sequence from China, A/Hunan/SWL3/2009, was released yesterday, a day after the CDC released a sequence, A/Singapore/57/2009 at GISAID, which was a day after the sequence from Denmark, A/Denmark/528/2009, was released. All three isolates have H274Y appended onto a different pandemic H1N1 genetic background, and all three backgrounds were distinct from earlier sequences from Osaka, Yamaguchi, and Hong Kong. H274Y was also reported in isolates from patients in Quebec and Tokushima.

                    This pattern of H274Y on multiple H1N1 backgrounds was also seen in seasonal flu and recently released 2009 seasonal sequences from Central and South American countries also have H274Y, providing a large reservoir of H274Y, which can jump from N1 in seasonal H1N1 to N1 in pandemic H1N1.

                    Although details of the cases in Hunan and Singapore have not been released, most of the other cases involved patients who were on prophylactic Tamiflu. In Denmark and Tokushima, the patients developed symptoms on the 5th day of prophylactic treatment, raising doubts that the H274Y was due to a de novo mutation. The incubation period for wild type influenza is 2-4 days, so symptoms 5 days after the start of Tamiflu treatment are not likely to be due to de novo mutation, because the incubation period would be significantly longer than wild type, because the newly mutated virus would take longer than five days to grow to a level that would produce symptoms.

                    In addition, the repeated identification of the same polymorphism, H274Y, and the lack of detection of another resistant polymorphism, N294S, decreases the likelihood that random mutations are generating the resistance.

                    Instead, it is more likely that H274Y is circulating as a minor population, leading to a shorter incubation period than would be expected for de novo mutation, and a higher frequency of detection. The May 30 isolate date of the Singapore isolate coupled with the release date of August 6, raise concerns that the number of isolates with H274Y that either have not been sequenced or have not had sequences released, may be significant.

                    The concern was increased by recent <a rel="nofollow" href="http://www.recombinomics.com/News/08040902/H274Y_TX_Spread.html">reports</a> on multiple resistant isolates along the Texas / Mexican border. Although the claims of confirmed cases were denied, the detail associated with the cases suggests that there is some indication of resistance in this area. Similarly, earlier reports of patients who remained H1N1 positive after extended treatment with Tamiflu raises additional concern of resistant H1N1 that has not been isolated or sequenced.

                    The rapid spread of H274Y in pandemic H1N1 would not be a surprise. H274Y spread in seasonal flu has been described in <a rel="nofollow" href="http://precedings.nature.com/documents/2832/version/1">detail</a>, and the level rapidly increased to 100&#37;. The co-circulation of H1N1 seasonal flu with H274Y and widespread use of Tamiflu for treatment or prevention, increases the likelihood of rapid spread of H274Y in pandemic H1N1.

                    The recently released sequences, which contain H274Y on six different genetic backgrounds, including at least one patient who was not treated with Tamiflu, significantly increases concerns of additional worldwide spread in the near term.

                    .
                    "The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation

                    Comment


                    • #11
                      Re: Tamiflu Resistant Pandemic H1N1 Sequence from Hunan China Released

                      <a rel="nofollow" href="http://www.recombinomics.com/News/08090902/H274Y_Delays.html">Commentary</a>

                      .

                      Comment


                      • #12
                        Re: Tamiflu Resistant Pandemic H1N1 Sequence from Hunan China Released

                        PB1 travel log. Remember, PB1 in swine H1N1 is HUMAN H3N2 from the 1990's. Here is a "new" acquisition by the Hunan isolate, which is NOT a coincidence:

                        Code:
                         
                        gb|GQ463198.1|  Influenza A virus (A/Hunan/SWL3/2009(H1N1)) se...  40.1    0.046
                        gb|GQ229308.1|  Influenza A virus (A/swine/Hong Kong/78/2003(H...  40.1    0.046
                        gb|FJ970925.1|  Influenza A virus (A/swine/Guangdong/Z5/2003(H...  40.1    0.046
                        gb|EU692905.1|  Influenza A virus (A/swine/Minnesota/66727/200...  40.1    0.046
                        gb|CY039165.1|  Influenza A virus (A/Hong Kong/HKU5/2004(H3N2)...  40.1    0.046
                        gb|CY039085.1|  Influenza A virus (A/Sydney/5/1997(H3N2)) segm...  40.1    0.046
                        gb|CY038981.1|  Influenza A virus (A/Hong Kong/HKU10/2004(H3N2...  40.1    0.046
                        gb|CY038965.1|  Influenza A virus (A/Hong Kong/HKU7/2004(H3N2)...  40.1    0.046
                        gb|CY038941.1|  Influenza A virus (A/Hong Kong/HKU3/2004(H3N2)...  40.1    0.046
                        gb|CY038597.1|  Influenza A virus (A/Hong Kong/HKU12/2004(H3N2...  40.1    0.046
                        gb|CY038581.1|  Influenza A virus (A/Hong Kong/HKU8/2004(H3N2)...  40.1    0.046
                        gb|CY038573.1|  Influenza A virus (A/Hong Kong/HKU2/2004(H3N2)...  40.1    0.046
                        gb|CY037357.1|  Influenza A virus (A/Genoa/14/2003(H3N2)) segm...  40.1    0.046
                        gb|CY037349.1|  Influenza A virus (A/Genoa/1/2002(H3N2)) segme...  40.1    0.046
                        gb|CY036853.1|  Influenza A virus (A/Siena/1/1997(H3N2)) segme...  40.1    0.046
                        gb|CY036275.1|  Influenza A virus (A/ferret/Maryland/P10-UMD/2...  40.1    0.046
                        gb|EU798908.1|  Influenza A virus (A/swine/Korea/CY08/2007(H1N...  40.1    0.046
                        gb|EU798907.1|  Influenza A virus (A/swine/Korea/PZ14/2006(H1N...  40.1    0.046
                        gb|EU798906.1|  Influenza A virus (A/swine/Korea/PZ7/2006(H1N2...  40.1    0.046
                        gb|EU798905.1|  Influenza A virus (A/swine/Korea/PZ4/2006(H1N2...  40.1    0.046
                        gb|EU798904.1|  Influenza A virus (A/swine/Korea/Asan04/2006(H...  40.1    0.046
                        gb|EU798903.1|  Influenza A virus (A/swine/Korea/JL04/2005(H1N...  40.1    0.046
                        gb|EU798902.1|  Influenza A virus (A/swine/Korea/JL02/2005(H1N...  40.1    0.046
                        gb|EU798901.1|  Influenza A virus (A/swine/Korea/JL01/2005(H1N...  40.1    0.046
                        gb|EU798900.1|  Influenza A virus (A/swine/Korea/Hongsong2/200...  40.1    0.046
                        gb|EU982314.1|  Influenza A virus (A/turkey/TX/10-49-89/1989(H...  40.1    0.046
                        gb|EU655694.1|  Influenza A virus (A/swine/Sichuan/01/2006(H3N...  40.1    0.046
                        gb|CY034106.1|  Influenza A virus (A/Panama/2007/1999(H3N2)) s...  40.1    0.046
                        gb|EU097799.1|  Influenza A virus (A/New York/55/01(H3N2)) pol...  40.1    0.046
                        gb|EU097794.1|  Influenza A virus (A/Denmark/13/03(H3N2)) poly...  40.1    0.046
                        gb|EU097787.1|  Influenza A virus (A/Denmark/86/03(H1N2)) poly...  40.1    0.046
                        gb|EU097783.1|  Influenza A virus (A/Denmark/205/00(H3N2)) pol...  40.1    0.046
                        gb|EU097782.1|  Influenza A virus (A/Denmark/35/00(H3N2)) poly...  40.1    0.046
                        gb|EU097781.1|  Influenza A virus (A/Denmark/13/02(H3N2)) poly...  40.1    0.046
                        gb|EU097780.1|  Influenza A virus (A/Denmark/08/02(H3N2)) poly...  40.1    0.046
                        gb|EU097779.1|  Influenza A virus (A/Denmark/05/02(H3N2)) poly...  40.1    0.046
                        gb|EU097778.1|  Influenza A virus (A/Denmark/22/02(H3N2)) poly...  40.1    0.046
                        gb|EU097776.1|  Influenza A virus (A/Denmark/81/03(H3N2)) poly...  40.1    0.046
                        gb|EU097775.1|  Influenza A virus (A/Denmark/15-02/2004(H3N2))...  40.1    0.046
                        gb|EU273801.1|  Influenza A virus (A/swine/Guangdong/166/06(H3...  40.1    0.046
                        gb|EU273800.1|  Influenza A virus (A/swine/Guangdong/165/06(H3...  40.1    0.046
                        gb|EU273799.1|  Influenza A virus (A/swine/Guangdong/164/06(H3...  40.1    0.046
                        gb|EU116037.1|  Influenza A virus (A/Swine/Shandong/3/2005/H3N...  40.1    0.046
                        gb|CY025056.1|  Influenza A virus (A/Auckland/610/2002(H3N2)) ...  40.1    0.046
                        gb|CY025048.1|  Influenza A virus (A/Auckland/598/2000(H3N2)) ...  40.1    0.046
                        gb|CY025024.1|  Influenza A virus (A/Auckland/583/2000(H3N2)) ...  40.1    0.046
                        gb|CY023080.1|  Influenza A virus (A/Auckland/615/2002(H3N2)) ...  40.1    0.046
                        gb|CY023072.1|  Influenza A virus (A/Auckland/604/2001(H3N2)) ...  40.1    0.046
                        gb|CY023064.1|  Influenza A virus (A/Auckland/603/2001(H3N2)) ...  40.1    0.046
                        gb|CY023056.1|  Influenza A virus (A/Auckland/601/2000(H3N2)) ...  40.1    0.046
                        gb|CY023048.1|  Influenza A virus (A/Auckland/600/2000(H3N2)) ...  40.1    0.046
                        gb|CY023040.1|  Influenza A virus (A/Auckland/599/2000(H3N2)) ...  40.1    0.046
                        gb|CY023032.1|  Influenza A virus (A/Auckland/596/2000(H3N2)) ...  40.1    0.046
                        gb|CY022563.1|  Influenza A virus (A/Auckland/609/2002(H3N2)) ...  40.1    0.046
                        gb|CY022555.1|  Influenza A virus (A/Auckland/608/2002(H3N2)) ...  40.1    0.046
                        gb|CY022531.1|  Influenza A virus (A/Auckland/602/2001(H3N2)) ...  40.1    0.046
                        gb|CY022523.1|  Influenza A virus (A/Auckland/593/2000(H3N2)) ...  40.1    0.046
                        gb|CY022259.1|  Influenza A virus (A/Western Australia/4/2000(...  40.1    0.046
                        gb|CY022211.1|  Influenza A virus (A/Auckland/614/2002(H3N2)) ...  40.1    0.046
                        gb|CY022187.1|  Influenza A virus (A/Auckland/607/2001(H3N2)) ...  40.1    0.046
                        gb|CY021955.1|  Influenza A virus (A/South Australia/73/2000(H...  40.1    0.046
                        gb|CY021931.1|  Influenza A virus (A/South Australia/47/2000(H...  40.1    0.046
                        gb|CY021923.1|  Influenza A virus (A/South Australia/16/2000(H...  40.1    0.046
                        gb|CY021787.1|  Influenza A virus (A/South Australia/81/2000(H...  40.1    0.046
                        gb|CY021779.1|  Influenza A virus (A/South Australia/72/2000(H...  40.1    0.046
                        gb|CY021747.1|  Influenza A virus (A/South Australia/11/2000(H...  40.1    0.046
                        gb|CY021227.1|  Influenza A virus (A/blue-winged teal/Ohio/133...  40.1    0.046
                        gb|CY021067.1|  Influenza A virus (A/New South Wales/3/1999(H3...  40.1    0.046
                        gb|CY020499.1|  Influenza A virus (A/Queensland/6/2000(H3N2)) ...  40.1    0.046
                        gb|CY020315.1|  Influenza A virus (A/Queensland/10/2000(H3N2))...  40.1    0.046
                        gb|CY020219.1|  Influenza A virus (A/South Australia/15/2000(H...  40.1    0.046
                        gb|CY020211.1|  Influenza A virus (A/New South Wales/19/1999(H...  40.1    0.046
                        gb|CY020203.1|  Influenza A virus (A/New South Wales/7/1999(H3...  40.1    0.046
                        gb|CY020035.1|  Influenza A virus (A/Queensland/44/2004(H3N2))...  40.1    0.046
                        gb|CY020027.1|  Influenza A virus (A/South Australia/80/2000(H...  40.1    0.046
                        gb|CY020019.1|  Influenza A virus (A/South Australia/49/2000(H...  40.1    0.046
                        gb|CY019995.1|  Influenza A virus (A/Wellington/21/2000(H3N2))...  40.1    0.046
                        gb|CY019987.1|  Influenza A virus (A/Canterbury/50/2000(H3N2))...  40.1    0.046
                        gb|CY019937.1|  Influenza A virus (A/Western Australia/34/2002...  40.1    0.046
                        gb|CY019011.1|  Influenza A virus (A/Queensland/41/2004(H3N2))...  40.1    0.046
                        gb|CY019003.1|  Influenza A virus (A/Queensland/35/2003(H3N2))...  40.1    0.046
                        gb|CY018995.1|  Influenza A virus (A/Queensland/34/2003(H3N2))...  40.1    0.046
                        gb|CY018987.1|  Influenza A virus (A/Queensland/32/2003(H3N2))...  40.1    0.046
                        gb|CY018979.1|  Influenza A virus (A/Queensland/31/2003(H3N2))...  40.1    0.046
                        gb|CY018963.1|  Influenza A virus (A/Queensland/14/2001(H3N2))...  40.1    0.046
                        gb|CY017963.1|  Influenza A virus (A/Queensland/42/2004(H3N2))...  40.1    0.046
                        gb|CY017955.1|  Influenza A virus (A/Queensland/40/2003(H3N2))...  40.1    0.046
                        gb|CY017947.1|  Influenza A virus (A/Queensland/38/2003(H3N2))...  40.1    0.046
                        gb|CY017939.1|  Influenza A virus (A/Queensland/37/2003(H3N2))...  40.1    0.046
                        gb|CY017915.1|  Influenza A virus (A/Queensland/27/2002(H3N2))...  40.1    0.046
                        gb|CY017907.1|  Influenza A virus (A/Queensland/22/2002(H3N2))...  40.1    0.046
                        gb|CY017899.1|  Influenza A virus (A/Queensland/19/2001(H3N2))...  40.1    0.046
                        gb|CY017891.1|  Influenza A virus (A/Queensland/7/2000(H3N2)) ...  40.1    0.046
                        gb|CY017811.1|  Influenza A virus (A/South Australia/2/2000(H3...  40.1    0.046
                        gb|CY017803.1|  Influenza A virus (A/Western Australia/49/2003...  40.1    0.046
                        gb|CY017633.1|  Influenza A virus (A/Queensland/17/2001(H3N2))...  40.1    0.046
                        gb|CY017505.1|  Influenza A virus (A/Queensland/15/2001(H3N2))...  40.1    0.046
                        gb|CY017601.1|  Influenza A virus (A/Queensland/48/2004(H3N2))...  40.1    0.046
                        gb|CY017593.1|  Influenza A virus (A/Queensland/47/2004(H3N2))...  40.1    0.046
                        gb|CY017585.1|  Influenza A virus (A/Queensland/39/2003(H3N2))...  40.1    0.046
                        gb|CY017577.1|  Influenza A virus (A/Queensland/36/2003(H3N2))...  40.1    0.046
                        gb|CY017569.1|  Influenza A virus (A/Queensland/33/2003(H3N2))...  40.1    0.046
                        gb|CY017529.1|  Influenza A virus (A/Queensland/20/2001(H3N2))...  40.1    0.046
                        gb|CY017521.1|  Influenza A virus (A/Queensland/18/2001(H3N2))...  40.1    0.046
                        gb|CY017513.1|  Influenza A virus (A/Queensland/16/2001(H3N2))...  40.1    0.046
                        gb|CY017497.1|  Influenza A virus (A/Queensland/12/2001(H3N2))...  40.1    0.046
                        gb|CY017489.1|  Influenza A virus (A/Queensland/11/2001(H3N2))...  40.1    0.046
                        gb|CY017481.1|  Influenza A virus (A/Queensland/9/2000(H3N2)) ...  40.1    0.046
                        gb|CY017473.1|  Influenza A virus (A/Queensland/8/2000(H3N2)) ...  40.1    0.046
                        gb|CY017465.1|  Influenza A virus (A/Queensland/5/2000(H3N2)) ...  40.1    0.046
                        gb|CY017457.1|  Influenza A virus (A/Queensland/3/2000(H3N2)) ...  40.1    0.046
                        gb|CY017449.1|  Influenza A virus (A/Queensland/2/2000(H3N2)) ...  40.1    0.046
                        gb|CY017401.1|  Influenza A virus (A/South Australia/77/2000(H...  40.1    0.046
                        gb|CY017393.1|  Influenza A virus (A/South Australia/75/2000(H...  40.1    0.046
                        gb|CY017353.1|  Influenza A virus (A/Western Australia/9/2000(...  40.1    0.046
                        gb|CY017345.1|  Influenza A virus (A/Western Australia/7/2000(...  40.1    0.046
                        gb|CY017337.1|  Influenza A virus (A/Western Australia/5/2000(...  40.1    0.046
                        gb|CY017329.1|  Influenza A virus (A/Western Australia/1/2000(...  40.1    0.046
                        gb|CY017273.1|  Influenza A virus (A/Queensland/4/2000(H3N2)) ...  40.1    0.046
                        gb|CY017265.1|  Influenza A virus (A/Queensland/1/2000(H3N2)) ...  40.1    0.046
                        gb|CY017177.1|  Influenza A virus (A/South Australia/76/2000(H...  40.1    0.046
                        gb|CY017169.1|  Influenza A virus (A/South Australia/52/2000(H...  40.1    0.046
                        gb|CY017097.1|  Influenza A virus (A/Western Australia/32/2002...  40.1    0.046
                        gb|CY017089.1|  Influenza A virus (A/Western Australia/27/2002...  40.1    0.046
                        gb|CY016777.1|  Influenza A virus (A/South Australia/74/2000(H...  40.1    0.046
                        gb|CY016769.1|  Influenza A virus (A/South Australia/71/2000(H...  40.1    0.046
                        gb|CY016761.1|  Influenza A virus (A/South Australia/68/2000(H...  40.1    0.046
                        gb|CY016753.1|  Influenza A virus (A/South Australia/67/2000(H...  40.1    0.046
                        gb|CY016745.1|  Influenza A virus (A/South Australia/66/2000(H...  40.1    0.046
                        gb|CY016721.1|  Influenza A virus (A/South Australia/62/2000(H...  40.1    0.046
                        gb|CY016713.1|  Influenza A virus (A/South Australia/59/2000(H...  40.1    0.046
                        gb|CY016657.1|  Influenza A virus (A/New South Wales/22/1999(H...  40.1    0.046
                        gb|CY016641.1|  Influenza A virus (A/New South Wales/17/1999(H...  40.1    0.046
                        gb|CY016633.1|  Influenza A virus (A/New South Wales/4/1999(H3...  40.1    0.046
                        gb|CY016593.1|  Influenza A virus (A/New South Wales/35/2000(H...  40.1    0.046
                        gb|CY016585.1|  Influenza A virus (A/New South Wales/34/2000(H...  40.1    0.046
                        gb|CY016577.1|  Influenza A virus (A/New South Wales/32/2000(H...  40.1    0.046
                        gb|CY016561.1|  Influenza A virus (A/New South Wales/21/1999(H...  40.1    0.046
                        gb|CY016553.1|  Influenza A virus (A/New South Wales/16/1999(H...  40.1    0.046
                        gb|CY016545.1|  Influenza A virus (A/New South Wales/15/1999(H...  40.1    0.046
                        gb|CY016537.1|  Influenza A virus (A/New South Wales/8/1999(H3...  40.1    0.046
                        gb|CY016529.1|  Influenza A virus (A/New South Wales/6/1999(H3...  40.1    0.046
                        gb|CY016521.1|  Influenza A virus (A/New South Wales/5/1999(H3...  40.1    0.046
                        gb|CY016513.1|  Influenza A virus (A/New South Wales/2/1999(H3...  40.1    0.046
                        gb|CY016505.1|  Influenza A virus (A/Western Australia/12/2000...  40.1    0.046
                        gb|CY016497.1|  Influenza A virus (A/Western Australia/10/2000...  40.1    0.046
                        gb|CY016409.1|  Influenza A virus (A/Canterbury/75/2000(H3N2))...  40.1    0.046
                        gb|CY016274.1|  Influenza A virus (A/New South Wales/33/2000(H...  40.1    0.046
                        gb|CY016210.1|  Influenza A virus (A/Waikato/8/2000(H3N2)) seg...  40.1    0.046
                        gb|CY016122.1|  Influenza A virus (A/New South Wales/36/2000(H...  40.1    0.046
                        gb|CY016114.1|  Influenza A virus (A/New South Wales/29/2000(H...  40.1    0.046
                        gb|CY016106.1|  Influenza A virus (A/New South Wales/28/2000(H...  40.1    0.046
                        gb|CY016098.1|  Influenza A virus (A/New South Wales/27/2000(H...  40.1    0.046
                        gb|CY016090.1|  Influenza A virus (A/New South Wales/25/2000(H...  40.1    0.046
                        gb|CY016082.1|  Influenza A virus (A/New South Wales/20/1999(H...  40.1    0.046
                        gb|CY016074.1|  Influenza A virus (A/New South Wales/13/1999(H...  40.1    0.046
                        gb|CY015938.1|  Influenza A virus (A/Western Australia/58/2004...  40.1    0.046
                        gb|CY015874.1|  Influenza A virus (A/Western Australia/50/2003...  40.1    0.046
                        gb|CY015866.1|  Influenza A virus (A/Western Australia/48/2003...  40.1    0.046
                        gb|CY015858.1|  Influenza A virus (A/Western Australia/47/2003...  40.1    0.046
                        gb|CY015850.1|  Influenza A virus (A/Western Australia/46/2003...  40.1    0.046
                        gb|CY015842.1|  Influenza A virus (A/Western Australia/45/2003...  40.1    0.046
                        gb|CY015834.1|  Influenza A virus (A/Western Australia/44/2003...  40.1    0.046
                        gb|CY015826.1|  Influenza A virus (A/Western Australia/43/2003...  40.1    0.046
                        gb|CY015818.1|  Influenza A virus (A/Western Australia/42/2003...  40.1    0.046
                        gb|CY015802.1|  Influenza A virus (A/Western Australia/40/2003...  40.1    0.046
                        gb|CY015794.1|  Influenza A virus (A/Western Australia/39/2003...  40.1    0.046
                        gb|CY015786.1|  Influenza A virus (A/Western Australia/38/2003...  40.1    0.046
                        gb|CY015778.1|  Influenza A virus (A/Western Australia/37/2003...  40.1    0.046
                        gb|CY015762.1|  Influenza A virus (A/Western Australia/35/2002...  40.1    0.046
                        gb|CY015746.1|  Influenza A virus (A/Western Australia/30/2002...  40.1    0.046
                        gb|CY015738.1|  Influenza A virus (A/Western Australia/29/2002...  40.1    0.046
                        gb|CY015730.1|  Influenza A virus (A/Western Australia/28/2002...  40.1    0.046
                        gb|CY015714.1|  Influenza A virus (A/Western Australia/25/2002...  40.1    0.046
                        gb|CY015706.1|  Influenza A virus (A/Western Australia/17/2001...  40.1    0.046
                        gb|CY015698.1|  Influenza A virus (A/Western Australia/16/2001...  40.1    0.046
                        gb|CY015690.1|  Influenza A virus (A/Western Australia/14/2001...  40.1    0.046
                        gb|CY015682.1|  Influenza A virus (A/Western Australia/13/2001...  40.1    0.046
                        gb|CY015674.1|  Influenza A virus (A/Western Australia/11/2000...  40.1    0.046
                        gb|CY015666.1|  Influenza A virus (A/Western Australia/8/2000(...  40.1    0.046
                        gb|CY015658.1|  Influenza A virus (A/Western Australia/3/2000(...  40.1    0.046
                        gb|CY015650.1|  Influenza A virus (A/Western Australia/2/2000(...  40.1    0.046
                        gb|CY015554.1|  Influenza A virus (A/Dunedin/1/2002(H3N2)) seg...  40.1    0.046
                        gb|CY015522.1|  Influenza A virus (A/New York/601/1996(H3N2)) ...  40.1    0.046
                        gb|DQ923519.1|  Influenza A virus (A/swine/Korea/CN22/2006(H3N...  40.1    0.046
                        gb|DQ923518.1|  Influenza A virus (A/swine/Korea/PZ72-1/2006(H...  40.1    0.046
                        gb|CY013861.1|  Influenza A virus (A/Waikato/15/2000(H3N2)) se...  40.1    0.046
                        gb|DQ415299.1|  Influenza A virus (A/TW/3565/02(H3N2)) PB1 (PB...  40.1    0.046
                        gb|DQ415298.1|  Influenza A virus (A/TW/3446/02(H3N2)) PB1 (PB...  40.1    0.046
                        gb|CY013909.1|  Influenza A virus (A/Wellington/30/2000(H3N2))...  40.1    0.046
                        gb|CY013901.1|  Influenza A virus (A/Wellington/26/2000(H3N2))...  40.1    0.046
                        gb|CY013811.1|  Influenza A virus (A/New York/C4/2002(H3N2)) s...  40.1    0.046
                        gb|CY013451.1|  Influenza A virus (A/Dunedin/38/2003(H3N2)) se...  40.1    0.046
                        gb|CY013443.1|  Influenza A virus (A/Waikato/108/2003(H3N2)) s...  40.1    0.046
                        gb|CY013435.1|  Influenza A virus (A/Waikato/15/2003(H3N2)) se...  40.1    0.046
                        gb|CY013419.1|  Influenza A virus (A/Waikato/31/2002(H3N2)) se...  40.1    0.046
                        gb|CY013411.1|  Influenza A virus (A/Wellington/28/2000(H3N2))...  40.1    0.046
                        gb|CY013403.1|  Influenza A virus (A/Waikato/17/2000(H3N2)) se...  40.1    0.046
                        gb|CY013395.1|  Influenza A virus (A/Waikato/16/2000(H3N2)) se...  40.1    0.046
                        gb|CY013381.1|  Influenza A virus (A/Dunedin/3/2000(H3N2)) seg...  40.1    0.046
                        gb|CY013222.1|  Influenza A virus (A/Western Australia/15/2001...  40.1    0.046
                        gb|CY013150.1|  Influenza A virus (A/Waikato/94/2003(H3N2)) se...  40.1    0.046
                        gb|CY013142.1|  Influenza A virus (A/Waikato/54/2003(H3N2)) se...  40.1    0.046
                        gb|CY013134.1|  Influenza A virus (A/Waikato/53/2003(H3N2)) se...  40.1    0.046
                        gb|CY013126.1|  Influenza A virus (A/Waikato/46/2003(H3N2)) se...  40.1    0.046
                        gb|CY013118.1|  Influenza A virus (A/Waikato/21/2003(H3N2)) se...  40.1    0.046
                        gb|CY013110.1|  Influenza A virus (A/Dunedin/18/2002(H3N2)) se...  40.1    0.046
                        gb|CY013102.1|  Influenza A virus (A/Waikato/36/2002(H3N2)) se...  40.1    0.046
                        gb|CY013086.1|  Influenza A virus (A/Wellington/9/2002(H3N2)) ...  40.1    0.046
                        gb|CY013078.1|  Influenza A virus (A/Waikato/5/2001(H3N2)) seg...  40.1    0.046
                        gb|CY013070.1|  Influenza A virus (A/Waikato/20/2000(H3N2)) se...  40.1    0.046
                        gb|CY013062.1|  Influenza A virus (A/Waikato/9/2000(H3N2)) seg...  40.1    0.046
                        gb|CY013054.1|  Influenza A virus (A/Waikato/6/2000(H3N2)) seg...  40.1    0.046
                        gb|CY012854.1|  Influenza A virus (A/New York/554/1996(H3N2)) ...  40.1    0.046
                        gb|CY012670.1|  Influenza A virus (A/Wellington/49/2003(H3N2))...  40.1    0.046
                        gb|CY012662.1|  Influenza A virus (A/Wellington/47/2003(H3N2))...  40.1    0.046
                        gb|CY012654.1|  Influenza A virus (A/Wellington/9/2003(H3N2)) ...  40.1    0.046
                        gb|CY012638.1|  Influenza A virus (A/Waikato/7/2000(H3N2)) seg...  40.1    0.046
                        gb|CY012630.1|  Influenza A virus (A/Waikato/4/2000(H3N2)) seg...  40.1    0.046
                        gb|CY012622.1|  Influenza A virus (A/Dunedin/1/2000 (H3N2)) se...  40.1    0.046
                        gb|CY012438.1|  Influenza A virus (A/Canterbury/97/2000(H3N2))...  40.1    0.046
                        gb|CY012430.1|  Influenza A virus (A/Waikato/148/2003(H3N2)) s...  40.1    0.046
                        gb|CY012422.1|  Influenza A virus (A/Waikato/147/2003(H3N2)) s...  40.1    0.046
                        gb|CY012414.1|  Influenza A virus (A/Waikato/139/2003(H3N2)) s...  40.1    0.046
                        gb|CY012406.1|  Influenza A virus (A/Waikato/133/2003(H3N2)) s...  40.1    0.046
                        gb|CY012398.1|  Influenza A virus (A/Waikato/129/2003(H3N2)) s...  40.1    0.046
                        gb|CY012390.1|  Influenza A virus (A/Waikato/122/2003(H3N2)) s...  40.1    0.046
                        gb|CY012382.1|  Influenza A virus (A/Wellington/53/2003(H3N2))...  40.1    0.046
                        gb|CY012374.1|  Influenza A virus (A/Waikato/115/2003(H3N2)) s...  40.1    0.046
                        gb|CY012366.1|  Influenza A virus (A/Waikato/29/2003(H3N2)) se...  40.1    0.046
                        gb|CY012358.1|  Influenza A virus (A/Waikato/156/2003(H3N2)) s...  40.1    0.046
                        gb|CY012350.1|  Influenza A virus (A/Waikato/155/2003(H3N2)) s...  40.1    0.046
                        gb|CY012334.1|  Influenza A virus (A/Wellington/7/2002(H3N2)) ...  40.1    0.046
                        gb|CY012326.1|  Influenza A virus (A/Waikato/105/2001(H3N2)) s...  40.1    0.046
                        gb|CY012318.1|  Influenza A virus (A/Wellington/34/2001(H3N2))...  40.1    0.046
                        gb|CY012214.1|  Influenza A virus (A/New York/598/1996(H3N2)) ...  40.1    0.046
                        gb|CY012206.1|  Influenza A virus (A/New York/556/1996(H3N2)) ...  40.1    0.046
                        gb|CY012102.1|  Influenza A virus (A/Waikato/150/2003(H3N2)) s...  40.1    0.046
                        gb|CY012094.1|  Influenza A virus (A/Waikato/102/2003(H3N2)) s...  40.1    0.046
                        gb|CY012086.1|  Influenza A virus (A/Waikato/91/2003(H3N2)) se...  40.1    0.046
                        gb|CY012078.1|  Influenza A virus (A/Waikato/154/2003(H3N2)) s...  40.1    0.046
                        gb|CY012070.1|  Influenza A virus (A/Wellington/34/2003(H3N2))...  40.1    0.046
                        gb|CY012046.1|  Influenza A virus (A/Wellington/79/2002(H3N2))...  40.1    0.046
                        gb|CY012022.1|  Influenza A virus (A/Wellington/71/2002(H3N2))...  40.1    0.046
                        gb|CY011998.1|  Influenza A virus (A/Wellington/70/2002(H3N2))...  40.1    0.046
                        gb|CY011990.1|  Influenza A virus (A/Wellington/6/2002(H3N2)) ...  40.1    0.046
                        gb|CY011982.1|  Influenza A virus (A/Waikato/2/2002(H3N2)) seg...  40.1    0.046
                        gb|CY011974.1|  Influenza A virus (A/Waikato/1/2001(H3N2)) seg...  40.1    0.046
                        gb|CY011966.1|  Influenza A virus (A/Waikato/5/2000(H3N2)) seg...  40.1    0.046
                        gb|CY011814.1|  Influenza A virus (A/New York/647/1995(H3N2)) ...  40.1    0.046
                        gb|CY011774.1|  Influenza A virus (A/Waikato/120/2003(H3N2)) s...  40.1    0.046
                        gb|CY011766.1|  Influenza A virus (A/Waikato/75/2003(H3N2)) se...  40.1    0.046
                        gb|CY011758.1|  Influenza A virus (A/Waikato/61/2003(H3N2)) se...  40.1    0.046
                        gb|CY011750.1|  Influenza A virus (A/Wellington/28/2003(H3N2))...  40.1    0.046
                        gb|CY011742.1|  Influenza A virus (A/Wellington/25/2003(H3N2))...  40.1    0.046
                        gb|CY011734.1|  Influenza A virus (A/Waikato/3/2003(H3N2)) seg...  40.1    0.046
                        gb|CY011726.1|  Influenza A virus (A/Wellington/10/2003(H3N2))...  40.1    0.046
                        gb|CY011718.1|  Influenza A virus (A/Waikato/1/2003(H3N2)) seg...  40.1    0.046
                        gb|CY011710.1|  Influenza A virus (A/Wellington/4/2003(H3N2)) ...  40.1    0.046
                        gb|CY011702.1|  Influenza A virus (A/Wellington/3/2003(H3N2)) ...  40.1    0.046
                        gb|CY011694.1|  Influenza A virus (A/Wellington/86/2002(H3N2))...  40.1    0.046
                        gb|CY011654.1|  Influenza A virus (A/Waikato/21/2002(H3N2)) se...  40.1    0.046
                        gb|CY011630.1|  Influenza A virus (A/Waikato/5/2002(H3N2)) seg...  40.1    0.046
                        gb|CY011622.1|  Influenza A virus (A/Wellington/22/2001(H3N2))...  40.1    0.046
                        gb|CY011598.1|  Influenza A virus (A/Waikato/1/2000(H3N2)) seg...  40.1    0.046
                        gb|CY011430.1|  Influenza A virus (A/New York/577/1996(H3N2)) ...  40.1    0.046
                        gb|CY011422.1|  Influenza A virus (A/New York/571/1996(H3N2)) ...  40.1    0.046
                        gb|CY011270.1|  Influenza A virus (A/New York/559/1996(H3N2)) ...  40.1    0.046
                        gb|CY011262.1|  Influenza A virus (A/New York/557/1996(H3N2)) ...  40.1    0.046
                        gb|CY011142.1|  Influenza A virus (A/New York/602/1996(H3N2)) ...  40.1    0.046
                        gb|CY011070.1|  Influenza A virus (A/Canterbury/62/2000(H3N2))...  40.1    0.046
                        gb|CY010802.1|  Influenza A virus (A/New York/555/1996(H3N2)) ...  40.1    0.046
                        gb|DQ508863.1|  Influenza A virus (A/Panama/2007/1999(H3N2)) p...  40.1    0.046
                        gb|DQ487333.1|  Influenza A virus (A/Panama/2007/1999(H3N2)) s...  40.1    0.046
                        gb|DQ487328.1|  Influenza A virus (A/Moscow/10/99(H3N2)) segme...  40.1    0.046
                        gb|CY010754.1|  Influenza A virus (A/New York/648/1995(H3N2)) ...  40.1    0.046
                        gb|CY010738.1|  Influenza A virus (A/New York/637/1996(H3N2)) ...  40.1    0.046
                        gb|CY010722.1|  Influenza A virus (A/New York/631/1996(H3N2)) ...  40.1    0.046
                        gb|CY010698.1|  Influenza A virus (A/New York/622/1996(H3N2)) ...  40.1    0.046
                        gb|CY010650.1|  Influenza A virus (A/New York/610/1995(H3N2)) ...  40.1    0.046
                        gb|CY010642.1|  Influenza A virus (A/New York/609/1995(H3N2)) ...  40.1    0.046
                        gb|CY010618.1|  Influenza A virus (A/New York/603/1996(H3N2)) ...  40.1    0.046
                        gb|CY010610.1|  Influenza A virus (A/New York/561/1996(H3N2)) ...  40.1    0.046
                        gb|CY010602.1|  Influenza A virus (A/New York/578/1996(H3N2)) ...  40.1    0.046
                        gb|CY009498.1|  Influenza A virus (A/New York/570/1996(H3N2)) ...  40.1    0.046
                        gb|CY010554.1|  Influenza A virus (A/Canterbury/36/2001(H3N2))...  40.1    0.046
                        gb|CY009098.1|  Influenza A virus (A/Canterbury/92/2000(H3N2))...  40.1    0.046
                        gb|CY010066.1|  Influenza A virus (A/New York/596/1996(H3N2)) ...  40.1    0.046
                        gb|CY010058.1|  Influenza A virus (A/New York/595/1996(H3N2)) ...  40.1    0.046
                        gb|CY010034.1|  Influenza A virus (A/New York/591/1996(H3N2)) ...  40.1    0.046
                        gb|CY010026.1|  Influenza A virus (A/New York/582/1996(H3N2)) ...  40.1    0.046
                        gb|CY010018.1|  Influenza A virus (A/New York/567/1996(H3N2)) ...  40.1    0.046
                        gb|CY010010.1|  Influenza A virus (A/New York/563/1996(H3N2)) ...  40.1    0.046
                        gb|CY010002.1|  Influenza A virus (A/New York/562/1996(H3N2)) ...  40.1    0.046
                        gb|CY009994.1|  Influenza A virus (A/New York/536/1998(H3N2)) ...  40.1    0.046
                        gb|CY009954.1|  Influenza A virus (A/Canterbury/06/2001(H3N2))...  40.1    0.046
                        gb|CY009914.1|  Influenza A virus (A/New York/593/1996(H3N2)) ...  40.1    0.046
                        gb|CY009906.1|  Influenza A virus (A/New York/584/1996(H3N2)) ...  40.1    0.046
                        gb|CY009858.1|  Influenza A virus (A/Canterbury/146/2001(H3N2)...  40.1    0.046
                        gb|CY009754.1|  Influenza A virus (A/New York/597/1997(H3N2)) ...  40.1    0.046
                        gb|CY009738.1|  Influenza A virus (A/New York/589/1996(H3N2)) ...  40.1    0.046
                        gb|CY009730.1|  Influenza A virus (A/New York/588/1996(H3N2)) ...  40.1    0.046
                        gb|CY009714.1|  Influenza A virus (A/New York/586/1996(H3N2)) ...  40.1    0.046
                        gb|CY009706.1|  Influenza A virus (A/New York/585/1997(H3N2)) ...  40.1    0.046
                        gb|CY009690.1|  Influenza A virus (A/New York/580/1996(H3N2)) ...  40.1    0.046
                        gb|CY009666.1|  Influenza A virus (A/New York/568/1996(H3N2)) ...  40.1    0.046
                        gb|CY009650.1|  Influenza A virus (A/New York/558/1997(H3N2)) ...  40.1    0.046
                        gb|CY009594.1|  Influenza A virus (A/Canterbury/140/2001(H3N2)...  40.1    0.046
                        gb|CY009586.1|  Influenza A virus (A/Canterbury/50/2001(H3N2))...  40.1    0.046
                        gb|CY009578.1|  Influenza A virus (A/Canterbury/43/2001(H3N2))...  40.1    0.046
                        gb|CY009570.1|  Influenza A virus (A/West Coast/28/2001(H3N2))...  40.1    0.046
                        gb|CY009562.1|  Influenza A virus (A/Canterbury/07/2001(H3N2))...  40.1    0.046
                        gb|CY009506.1|  Influenza A virus (A/New York/573/1996(H3N2)) ...  40.1    0.046
                        gb|CY009490.1|  Influenza A virus (A/New York/569/1997(H3N2)) ...  40.1    0.046
                        gb|CY009442.1|  Influenza A virus (A/Canterbury/149/2001(H3N2)...  40.1    0.046
                        gb|CY009434.1|  Influenza A virus (A/West Coast/55/2001(H3N2))...  40.1    0.046
                        gb|CY009426.1|  Influenza A virus (A/Canterbury/44/2001(H3N2))...  40.1    0.046
                        gb|CY009418.1|  Influenza A virus (A/Canterbury/37/2001(H3N2))...  40.1    0.046
                        gb|CY009410.1|  Influenza A virus (A/West Coast/32/2001(H3N2))...  40.1    0.046
                        gb|CY009402.1|  Influenza A virus (A/Canterbury/10/2001(H3N2))...  40.1    0.046
                        gb|CY009394.1|  Influenza A virus (A/Canterbury/94/2000(H3N2))...  40.1    0.046
                        gb|CY006169.1|  Influenza A virus (A/New York/397/1999(H3N2)) ...  40.1    0.046
                        gb|CY006074.1|  Influenza A virus (A/New York/455/1999(H3N2)) ...  40.1    0.046
                        gb|CY006066.1|  Influenza A virus (A/New York/452/1999(H3N2)) ...  40.1    0.046
                        gb|CY003815.1|  Influenza A virus (A/New York/429/2000(H3N2)) ...  40.1    0.046
                        gb|CY003807.1|  Influenza A virus (A/New York/428/1999(H3N2)) ...  40.1    0.046
                        gb|CY003799.1|  Influenza A virus (A/New York/423/1999(H3N2)) ...  40.1    0.046
                        gb|CY003791.1|  Influenza A virus (A/New York/422/1999(H3N2)) ...  40.1    0.046
                        gb|CY003831.1|  Influenza A virus (A/New York/440/2000(H3N2)) ...  40.1    0.046
                        gb|CY003823.1|  Influenza A virus (A/New York/432/2000(H3N2)) ...  40.1    0.046
                        gb|CY003783.1|  Influenza A virus (A/New York/420/2002(H3N2)) ...  40.1    0.046
                        gb|CY003702.1|  Influenza A virus (A/New York/489/2003(H1N2)) ...  40.1    0.046
                        gb|CY003638.1|  Influenza A virus (A/New York/459/1999(H3N2)) ...  40.1    0.046
                        gb|CY003622.1|  Influenza A virus (A/New York/457/1999(H3N2)) ...  40.1    0.046
                        gb|CY003606.1|  Influenza A virus (A/New York/454/1999(H3N2)) ...  40.1    0.046
                        gb|CY003598.1|  Influenza A virus (A/New York/453/1999(H3N2)) ...  40.1    0.046
                        gb|CY003590.1|  Influenza A virus (A/New York/451/1999(H3N2)) ...  40.1    0.046
                        gb|CY003582.1|  Influenza A virus (A/New York/450/1999(H3N2)) ...  40.1    0.046
                        gb|CY003574.1|  Influenza A virus (A/New York/449/1999(H3N2)) ...  40.1    0.046
                        gb|CY003566.1|  Influenza A virus (A/New York/448/1998(H3N2)) ...  40.1    0.046
                        gb|CY003462.1|  Influenza A virus (A/New York/439/2000(H3N2)) ...  40.1    0.046
                        gb|CY003454.1|  Influenza A virus (A/New York/430/2000(H3N2)) ...  40.1    0.046
                        gb|CY003446.1|  Influenza A virus (A/New York/425/1999(H3N2)) ...  40.1    0.046
                        gb|CY003438.1|  Influenza A virus (A/New York/421/1999(H3N2)) ...  40.1    0.046
                        gb|CY003430.1|  Influenza A virus (A/New York/407/2002(H3N2)) ...  40.1    0.046
                        gb|AF258823.1|  Influenza A virus (A/Hong Kong/498/97(H3N2)) R...  40.1    0.046
                        gb|AF258822.1|  Influenza A virus (A/Hong Kong/497/97(H3N2)) R...  40.1    0.046
                        gb|AY363482.1|  Influenza A virus (A/swine/Hong Kong/q066/99(H...  40.1    0.046
                        gb|AY363478.1|  Influenza A virus (A/swine/Hong Kong/9840/01(H...  40.1    0.046
                        gb|AY363477.1|  Influenza A virus (A/swine/Hong Kong/1311/01(H...  40.1    0.046
                        gb|AY363476.1|  Influenza A virus (A/swine/Hong Kong/9285/01(H...  40.1    0.046
                        gb|AY363475.1|  Influenza A virus (A/swine/Hong Kong/312/00(H3...  40.1    0.046
                        gb|AY363474.1|  Influenza A virus (A/swine/Hong Kong/7220/00(H...  40.1    0.046
                        gb|AY363473.1|  Influenza A virus (A/swine/Hong Kong/4361/99(H...  40.1    0.046
                        gb|CY003150.1|  Influenza A virus (A/New York/410/2002(H3N2)) ...  40.1    0.046
                        gb|CY003142.1|  Influenza A virus (A/New York/409/2002(H3N2)) ...  40.1    0.046
                        gb|CY003134.1|  Influenza A virus (A/New York/408/2002(H3N2)) ...  40.1    0.046
                        gb|CY003128.1|  Influenza A virus (A/New York/406/2002(H3N2)) ...  40.1    0.046
                        gb|CY003110.1|  Influenza A virus (A/New York/404/2002(H3N2)) ...  40.1    0.046
                        gb|CY003102.1|  Influenza A virus (A/New York/403/2002(H3N2)) ...  40.1    0.046
                        gb|CY003094.1|  Influenza A virus (A/New York/402/2001(H3N2)) ...  40.1    0.046
                        gb|CY003086.1|  Influenza A virus (A/New York/401/2001(H3N2)) ...  40.1    0.046
                        gb|CY003118.1|  Influenza A virus (A/New York/405/2002(H3N2)) ...  40.1    0.046
                        gb|CY003222.1|  Influenza A virus (A/New York/424/1999(H3N2)) ...  40.1    0.046
                        gb|CY003230.1|  Influenza A virus (A/New York/426/1999(H3N2)) ...  40.1    0.046
                        gb|CY003238.1|  Influenza A virus (A/New York/427/1999(H3N2)) ...  40.1    0.046
                        gb|CY003286.1|  Influenza A virus (A/New York/438/2000(H3N2)) ...  40.1    0.046
                        gb|CY003278.1|  Influenza A virus (A/New York/437/2000(H3N2)) ...  40.1    0.046
                        gb|CY003270.1|  Influenza A virus (A/New York/436/2000(H3N2)) ...  40.1    0.046
                        gb|CY003262.1|  Influenza A virus (A/New York/434/2000(H3N2)) ...  40.1    0.046
                        gb|CY003254.1|  Influenza A virus (A/New York/433/2000(H3N2)) ...  40.1    0.046
                        gb|CY003246.1|  Influenza A virus (A/New York/431/2000(H3N2)) ...  40.1    0.046
                        gb|CY003214.1|  Influenza A virus (A/New York/419/2002(H3N2)) ...  40.1    0.046
                        gb|CY003206.1|  Influenza A virus (A/New York/418/2002(H3N2)) ...  40.1    0.046
                        gb|CY003198.1|  Influenza A virus (A/New York/416/2002(H3N2)) ...  40.1    0.046
                        gb|CY003190.1|  Influenza A virus (A/New York/415/2002(H3N2)) ...  40.1    0.046
                        gb|CY003182.1|  Influenza A virus (A/New York/414/2002(H3N2)) ...  40.1    0.046
                        gb|CY003174.1|  Influenza A virus (A/New York/413/2002(H3N2)) ...  40.1    0.046
                        gb|CY003166.1|  Influenza A virus (A/New York/412/2002(H3N2)) ...  40.1    0.046
                        gb|CY003158.1|  Influenza A virus (A/New York/411/2002(H3N2)) ...  40.1    0.046
                        gb|CY002822.1|  Influenza A virus (A/New York/301/2001(H3N2)) ...  40.1    0.046
                        gb|DQ280230.1|  Influenza A virus (A/swine/Ontario/48235/04(H1...  40.1    0.046
                        gb|DQ280206.1|  Influenza A virus (A/swine/Ontario/55383/04(H1...  40.1    0.046
                        gb|CY002582.1|  Influenza A virus (A/New York/339/1999(H3N2)) ...  40.1    0.046
                        gb|CY002550.1|  Influenza A virus (A/New York/251/1998(H3N2)) ...  40.1    0.046
                        gb|CY002518.1|  Influenza A virus (A/New York/140/1999(H3N2)) ...  40.1    0.046
                        gb|CY002566.1|  Influenza A virus (A/New York/261/1999(H3N2)) ...  40.1    0.046
                        gb|CY002558.1|  Influenza A virus (A/New York/252/1999(H3N2)) ...  40.1    0.046
                        gb|CY002318.1|  Influenza A virus (A/New York/153/1999(H3N2)) ...  40.1    0.046
                        gb|CY002390.1|  Influenza A virus (A/New York/330/1998(H3N2)) ...  40.1    0.046
                        gb|CY002382.1|  Influenza A virus (A/New York/328/1998(H3N2)) ...  40.1    0.046
                        gb|CY002374.1|  Influenza A virus (A/New York/325/1999(H3N2)) ...  40.1    0.046
                        gb|CY002350.1|  Influenza A virus (A/New York/272/2003(H3N2)) ...  40.1    0.046
                        gb|CY002342.1|  Influenza A virus (A/New York/266/1999(H3N2)) ...  40.1    0.046
                        gb|CY001686.1|  Influenza A virus (A/New York/78/2002(H1N2)) s...  40.1    0.046
                        gb|CY002334.1|  Influenza A virus (A/New York/77/2001(H3N2)) s...  40.1    0.046
                        gb|CY002150.1|  Influenza A virus (A/New York/285/1999(H3N2)) ...  40.1    0.046
                        gb|CY002174.1|  Influenza A virus (A/New York/322/1999(H3N2)) ...  40.1    0.046
                        gb|CY002126.1|  Influenza A virus (A/New York/254/1998(H3N2)) ...  40.1    0.046
                        gb|CY002142.1|  Influenza A virus (A/New York/283/1999(H3N2)) ...  40.1    0.046
                        gb|CY002134.1|  Influenza A virus (A/New York/275/2002(H3N2)) ...  40.1    0.046
                        gb|CY002310.1|  Influenza A virus (A/New York/398/1999(H3N2)) ...  40.1    0.046
                        gb|CY002302.1|  Influenza A virus (A/New York/347/1999(H3N2)) ...  40.1    0.046
                        gb|AF483601.1|  Influenza A virus (A/Paris/908/97(H3N2)) polym...  40.1    0.046
                        gb|CY009170.1|  Influenza A virus (A/Canterbury/61/2000(H3N2))...  40.1    0.046
                        gb|CY009162.1|  Influenza A virus (A/Canterbury/67/2000(H3N2))...  40.1    0.046
                        gb|CY009138.1|  Influenza A virus (A/Canterbury/55/2000(H3N2))...  40.1    0.046
                        gb|CY009130.1|  Influenza A virus (A/Nelson Marlborough/1/2000...  40.1    0.046
                        gb|CY009122.1|  Influenza A virus (A/Canterbury/2/2000(H3N2)) ...  40.1    0.046
                        gb|CY009114.1|  Influenza A virus (A/Canterbury/179/1999(H3N2)...  40.1    0.046
                        gb|CY009090.1|  Influenza A virus (A/Canterbury/96/2000(H3N2))...  40.1    0.046
                        gb|CY009082.1|  Influenza A virus (A/Canterbury/87/2000(H3N2))...  40.1    0.046
                        gb|CY009026.1|  Influenza A virus (A/Canterbury/400/2003(H3N2)...  40.1    0.046
                        gb|CY009258.1|  Influenza A virus (A/New York/480/2004(H3N2)) ...  40.1    0.046
                        gb|CY009250.1|  Influenza A virus (A/New York/477/2003(H3N2)) ...  40.1    0.046
                        gb|CY009266.1|  Influenza A virus (A/New York/499/2004(H3N2)) ...  40.1    0.046
                        gb|CY009154.1|  Influenza A virus (A/Canterbury/58/2000(H3N2))...  40.1    0.046
                        gb|CY009106.1|  Influenza A virus (A/Canterbury/3/2000(H3N2)) ...  40.1    0.046
                        gb|CY002118.1|  Influenza A virus (A/Memphis/59/99(H3N2)) segm...  40.1    0.046
                        gb|CY002110.1|  Influenza A virus (A/Memphis/31/03(H3N2)) segm...  40.1    0.046
                        gb|CY001966.1|  Influenza A virus (A/New York/260/1999(H3N2)) ...  40.1    0.046
                        gb|CY001950.1|  Influenza A virus (A/New York/126/2002(H3N2)) ...  40.1    0.046
                        gb|CY001998.1|  Influenza A virus (A/New York/332/1999(H3N2)) ...  40.1    0.046
                        gb|CY001990.1|  Influenza A virus (A/New York/331/1999(H3N2)) ...  40.1    0.046
                        gb|CY000815.1|  Influenza A virus (A/New York/166/1999(H3N2)) ...  40.1    0.046
                        gb|CY001942.1|  Influenza A virus (A/New York/340/1999(H3N2)) ...  40.1    0.046
                        gb|CY001934.1|  Influenza A virus (A/New York/338/1999(H3N2)) ...  40.1    0.046
                        gb|CY001926.1|  Influenza A virus (A/New York/337/1999(H3N2)) ...  40.1    0.046
                        gb|CY001918.1|  Influenza A virus (A/New York/336/1999(H3N2)) ...  40.1    0.046
                        gb|CY001902.1|  Influenza A virus (A/New York/333/1999(H3N2)) ...  40.1    0.046
                        gb|CY001894.1|  Influenza A virus (A/New York/329/1999(H3N2)) ...  40.1    0.046
                        gb|CY001886.1|  Influenza A virus (A/New York/327/1999(H3N2)) ...  40.1    0.046
                        gb|CY001878.1|  Influenza A virus (A/New York/323/1999(H3N2)) ...  40.1    0.046
                        gb|CY001870.1|  Influenza A virus (A/New York/321/1999(H3N2)) ...  40.1    0.046
                        gb|CY001862.1|  Influenza A virus (A/New York/320/1999(H3N2)) ...  40.1    0.046
                        gb|CY001854.1|  Influenza A virus (A/New York/318/1999(H3N2)) ...  40.1    0.046
                        gb|CY001846.1|  Influenza A virus (A/New York/317/1999(H3N2)) ...  40.1    0.046
                        gb|CY001830.1|  Influenza A virus (A/New York/314/1999(H3N2)) ...  40.1    0.046
                        gb|CY001822.1|  Influenza A virus (A/New York/313/1998(H3N2)) ...  40.1    0.046
                        gb|CY001814.1|  Influenza A virus (A/New York/311/1999(H3N2)) ...  40.1    0.046
                        gb|CY001806.1|  Influenza A virus (A/New York/304/1998(H3N2)) ...  40.1    0.046
                        gb|CY001798.1|  Influenza A virus (A/New York/290/1999(H3N2)) ...  40.1    0.046
                        gb|CY001790.1|  Influenza A virus (A/New York/289/1998(H3N2)) ...  40.1    0.046
                        gb|CY001782.1|  Influenza A virus (A/New York/288/1999(H3N2)) ...  40.1    0.046
                        gb|CY001670.1|  Influenza A virus (A/New York/286/1999(H3N2)) ...  40.1    0.046
                        gb|CY001662.1|  Influenza A virus (A/New York/284/1999(H3N2)) ...  40.1    0.046
                        gb|CY001774.1|  Influenza A virus (A/New York/282/1999(H3N2)) ...  40.1    0.046
                        gb|CY001766.1|  Influenza A virus (A/New York/280/1999(H3N2)) ...  40.1    0.046
                        gb|CY001758.1|  Influenza A virus (A/New York/279/1999(H3N2)) ...  40.1    0.046
                        gb|CY001750.1|  Influenza A virus (A/New York/277/1999(H3N2)) ...  40.1    0.046
                        gb|CY001742.1|  Influenza A virus (A/New York/276/2002(H3N2)) ...  40.1    0.046
                        gb|CY001734.1|  Influenza A virus (A/New York/274/2002(H3N2)) ...  40.1    0.046
                        gb|CY001726.1|  Influenza A virus (A/New York/273/2001(H3N2)) ...  40.1    0.046
                        gb|CY001718.1|  Influenza A virus (A/New York/271/2003(H3N2)) ...  40.1    0.046
                        gb|CY001654.1|  Influenza A virus (A/New York/270/2003(H3N2)) ...  40.1    0.046
                        gb|CY001638.1|  Influenza A virus (A/New York/268/2003(H3N2)) ...  40.1    0.046
                        gb|CY001630.1|  Influenza A virus (A/New York/267/2003(H3N2)) ...  40.1    0.046
                        gb|CY001606.1|  Influenza A virus (A/New York/262/1999(H3N2)) ...  40.1    0.046
                        gb|CY001598.1|  Influenza A virus (A/New York/259/1999(H3N2)) ...  40.1    0.046
                        gb|CY001710.1|  Influenza A virus (A/New York/257/1999(H3N2)) ...  40.1    0.046
                        gb|CY001590.1|  Influenza A virus (A/New York/256/1998(H3N2)) ...  40.1    0.046
                        gb|CY001702.1|  Influenza A virus (A/New York/255/1999(H3N2)) ...  40.1    0.046
                        gb|CY001582.1|  Influenza A virus (A/New York/253/1999(H3N2)) ...  40.1    0.046
                        gb|CY001491.1|  Influenza A virus (A/New York/249/1998(H3N2)) ...  40.1    0.046
                        gb|CY001694.1|  Influenza A virus (A/New York/248/1999(H3N2)) ...  40.1    0.046
                        gb|CY001510.1|  Influenza A virus (A/New York/247/1998(H3N2)) ...  40.1    0.046
                        gb|CY001483.1|  Influenza A virus (A/New York/240/1998(H3N2)) ...  40.1    0.046
                        gb|CY001574.1|  Influenza A virus (A/New York/224/1998(H3N2)) ...  40.1    0.046
                        gb|CY001566.1|  Influenza A virus (A/New York/216/2003(H3N2)) ...  40.1    0.046
                        gb|CY001558.1|  Influenza A virus (A/New York/215/2003(H3N2)) ...  40.1    0.046
                        gb|CY001411.1|  Influenza A virus (A/New York/213/2003(H3N2)) ...  40.1    0.046
                        gb|CY000759.1|  Influenza A virus (A/New York/192/2003(H3N2)) ...  40.1    0.046
                        gb|CY001011.1|  Influenza A virus (A/New York/189/1999(H3N2)) ...  40.1    0.046
                        gb|CY001534.1|  Influenza A virus (A/New York/188/1999(H3N2)) ...  40.1    0.046
                        gb|CY001371.1|  Influenza A virus (A/New York/187/2000(H3N2)) ...  40.1    0.046
                        gb|CY000863.1|  Influenza A virus (A/New York/186/1999(H3N2)) ...  40.1    0.046
                        gb|CY000751.1|  Influenza A virus (A/New York/185/1999(H3N2)) ...  40.1    0.046
                        gb|CY001459.1|  Influenza A virus (A/New York/184/1999(H3N2)) ...  40.1    0.046
                        gb|CY001363.1|  Influenza A virus (A/New York/183/1999(H3N2)) ...  40.1    0.046
                        gb|CY001283.1|  Influenza A virus (A/New York/182/2000(H3N2)) ...  40.1    0.046
                        gb|CY001182.1|  Influenza A virus (A/New York/181/1999(H3N2)) ...  40.1    0.046
                        gb|CY000743.1|  Influenza A virus (A/New York/180/2000(H3N2)) ...  40.1    0.046
                        gb|CY000735.1|  Influenza A virus (A/New York/179/1999(H3N2)) ...  40.1    0.046
                        gb|CY000855.1|  Influenza A virus (A/New York/178/2000(H3N2)) ...  40.1    0.046
                        gb|CY000727.1|  Influenza A virus (A/New York/177/1999(H3N2)) ...  40.1    0.046
                        gb|CY000719.1|  Influenza A virus (A/New York/176/2000(H3N2)) ...  40.1    0.046
                        gb|CY000711.1|  Influenza A virus (A/New York/175/2000(H3N2)) ...  40.1    0.046
                        gb|CY000703.1|  Influenza A virus (A/New York/174/2000(H3N2)) ...  40.1    0.046
                        gb|CY000695.2|  Influenza A virus (A/New York/173/2000(H3N2)) ...  40.1    0.046
                        gb|CY000687.1|  Influenza A virus (A/New York/172/1999(H3N2)) ...  40.1    0.046
                        gb|CY000679.1|  Influenza A virus (A/New York/171/1999(H3N2)) ...  40.1    0.046
                        gb|CY000671.1|  Influenza A virus (A/New York/170/2000(H3N2)) ...  40.1    0.046
                        gb|CY000663.1|  Influenza A virus (A/New York/169/2000(H3N2)) ...  40.1    0.046
                        gb|CY000847.1|  Influenza A virus (A/New York/168/2000(H3N2)) ...  40.1    0.046
                        gb|CY000655.1|  Influenza A virus (A/New York/167/1999(H3N2)) ...  40.1    0.046
                        gb|CY001003.1|  Influenza A virus (A/New York/165/2000(H3N2)) ...  40.1    0.046
                        gb|CY001275.1|  Influenza A virus (A/New York/164/1999(H3N2)) ...  40.1    0.046
                        gb|CY000647.1|  Influenza A virus (A/New York/163/1999(H3N2)) ...  40.1    0.046
                        gb|CY001251.1|  Influenza A virus (A/New York/162/2000(H3N2)) ...  40.1    0.046
                        gb|CY000623.1|  Influenza A virus (A/New York/161/1999(H3N2)) ...  40.1    0.046
                        gb|CY000987.1|  Influenza A virus (A/New York/160/2000(H3N2)) ...  40.1    0.046
                        gb|CY000839.2|  Influenza A virus (A/New York/158/2000(H3N2)) ...  40.1    0.046
                        gb|CY000831.1|  Influenza A virus (A/New York/157/1999(H3N2)) ...  40.1    0.046
                        gb|CY001403.1|  Influenza A virus (A/New York/156/2000(H3N2)) ...  40.1    0.046
                        gb|CY001451.1|  Influenza A virus (A/New York/155/1999(H3N2)) ...  40.1    0.046
                        gb|CY000615.1|  Influenza A virus (A/New York/154/2000(H3N2)) ...  40.1    0.046
                        gb|CY001142.1|  Influenza A virus (A/New York/152/2000(H3N2)) ...  40.1    0.046
                        gb|CY000607.1|  Influenza A virus (A/New York/151/1999(H3N2)) ...  40.1    0.046
                        gb|CY000471.1|  Influenza A virus (A/New York/150/2000(H3N2)) ...  40.1    0.046
                        gb|CY000463.1|  Influenza A virus (A/New York/149/1999(H3N2)) ...  40.1    0.046
                        gb|CY000823.1|  Influenza A virus (A/New York/148/2000(H3N2)) ...  40.1    0.046
                        gb|CY000599.1|  Influenza A virus (A/New York/147/1999(H3N2)) ...  40.1    0.046
                        gb|CY001387.1|  Influenza A virus (A/New York/145/1999(H3N2)) ...  40.1    0.046
                        gb|CY000639.1|  Influenza A virus (A/New York/143/1999(H3N2)) ...  40.1    0.046
                        gb|CY001526.1|  Influenza A virus (A/New York/142/2000(H3N2)) ...  40.1    0.046
                        gb|CY000807.1|  Influenza A virus (A/New York/141/1999(H3N2)) ...  40.1    0.046
                        gb|CY001355.1|  Influenza A virus (A/New York/139/1999(H3N2)) ...  40.1    0.046
                        gb|CY000995.1|  Influenza A virus (A/New York/138/1999(H3N2)) ...  40.1    0.046
                        gb|CY001126.1|  Influenza A virus (A/New York/137/1999(H3N2)) ...  40.1    0.046
                        gb|CY001243.1|  Influenza A virus (A/New York/136/2002(H3N2)) ...  40.1    0.046
                        gb|CY000343.1|  Influenza A virus (A/New York/135/2002(H3N2)) ...  40.1    0.046
                        gb|CY000447.1|  Influenza A virus (A/New York/134/2002(H3N2)) ...  40.1    0.046
                        gb|CY000335.1|  Influenza A virus (A/New York/133/2002(H3N2)) ...  40.1    0.046
                        gb|CY000439.1|  Influenza A virus (A/New York/132/2002(H3N2)) ...  40.1    0.046
                        gb|CY000327.1|  Influenza A virus (A/New York/131/2001(H3N2)) ...  40.1    0.046
                        gb|CY000591.1|  Influenza A virus (A/New York/130/2002(H3N2)) ...  40.1    0.046
                        gb|CY000319.1|  Influenza A virus (A/New York/129/2002(H3N2)) ...  40.1    0.046
                        gb|CY000431.1|  Influenza A virus (A/New York/128/2002(H3N2)) ...  40.1    0.046
                        gb|CY000582.1|  Influenza A virus (A/New York/127/2001(H3N2)) ...  40.1    0.046
                        gb|CY001443.1|  Influenza A virus (A/New York/125/2002(H3N2)) ...  40.1    0.046
                        gb|CY000311.1|  Influenza A virus (A/New York/124/2001(H3N2)) ...  40.1    0.046
                        gb|CY001203.1|  Influenza A virus (A/New York/122/2002(H3N2)) ...  40.1    0.046
                        gb|CY000247.1|  Influenza A virus (A/New York/121/2002(H3N2)) ...  40.1    0.046
                        gb|CY000631.1|  Influenza A virus (A/New York/120/2002(H3N2)) ...  40.1    0.046
                        gb|CY000947.1|  Influenza A virus (A/New York/119/2002(H3N2)) ...  40.1    0.046
                        gb|CY001339.1|  Influenza A virus (A/New York/118/2002(H3N2)) ...  40.1    0.046
                        gb|CY000799.1|  Influenza A virus (A/New York/117/2002(H3N2)) ...  40.1    0.046
                        gb|CY000559.1|  Influenza A virus (A/New York/116/2002(H3N2)) ...  40.1    0.046
                        gb|CY000551.1|  Influenza A virus (A/New York/115/2002(H3N2)) ...  40.1    0.046
                        gb|CY000543.1|  Influenza A virus (A/New York/114/2002(H3N2)) ...  40.1    0.046
                        gb|CY000239.1|  Influenza A virus (A/New York/113/2002(H3N2)) ...  40.1    0.046
                        gb|CY001331.1|  Influenza A virus (A/New York/112/2002(H3N2)) ...  40.1    0.046
                        gb|CY000939.1|  Influenza A virus (A/New York/111/2002(H3N2)) ...  40.1    0.046
                        gb|CY000119.1|  Influenza A virus (A/New York/110/2002(H3N2)) ...  40.1    0.046
                        gb|CY000535.1|  Influenza A virus (A/New York/109/2002(H3N2)) ...  40.1    0.046
                        gb|CY000503.1|  Influenza A virus (A/New York/108/2002(H3N2)) ...  40.1    0.046
                        gb|CY001150.1|  Influenza A virus (A/New York/107/2002(H3N2)) ...  40.1    0.046
                        gb|CY000495.1|  Influenza A virus (A/New York/106/2002(H3N2)) ...  40.1    0.046
                        gb|CY001134.1|  Influenza A virus (A/New York/105/2002(H3N2)) ...  40.1    0.046
                        gb|CY001190.1|  Influenza A virus (A/New York/104/2002(H3N2)) ...  40.1    0.046
                        gb|CY000423.1|  Influenza A virus (A/New York/103/2002(H3N2)) ...  40.1    0.046
                        gb|CY001323.1|  Influenza A virus (A/New York/102/2002(H3N2)) ...  40.1    0.046
                        gb|CY001110.1|  Influenza A virus (A/New York/101/2002(H3N2)) ...  40.1    0.046
                        gb|CY000231.1|  Influenza A virus (A/New York/100/2002(H3N2)) ...  40.1    0.046
                        gb|CY001086.1|  Influenza A virus (A/New York/99/2002(H3N2)) s...  40.1    0.046
                        gb|CY001315.1|  Influenza A virus (A/New York/97/2002(H3N2)) s...  40.1    0.046
                        gb|CY000303.1|  Influenza A virus (A/New York/96/2002(H3N2)) s...  40.1    0.046
                        gb|CY000223.1|  Influenza A virus (A/New York/95/2002(H3N2)) s...  40.1    0.046
                        gb|CY001174.1|  Influenza A virus (A/New York/94/2001(H3N2)) s...  40.1    0.046
                        gb|CY000931.1|  Influenza A virus (A/New York/93/2002(H3N2)) s...  40.1    0.046
                        gb|CY000295.1|  Influenza A virus (A/New York/92/2002(H3N2)) s...  40.1    0.046
                        gb|CY000215.1|  Influenza A virus (A/New York/91/2002(H3N2)) s...  40.1    0.046
                        gb|CY000415.1|  Influenza A virus (A/New York/90/2002(H3N2)) s...  40.1    0.046
                        gb|CY000407.1|  Influenza A virus (A/New York/89/2002(H3N2)) s...  40.1    0.046
                        gb|CY001078.1|  Influenza A virus (A/New York/88/2002(H3N2)) s...  40.1    0.046
                        gb|CY000399.1|  Influenza A virus (A/New York/87/2002(H3N2)) s...  40.1    0.046
                        gb|CY000287.1|  Influenza A virus (A/New York/86/2002(H3N2)) s...  40.1    0.046
                        gb|CY000391.1|  Influenza A virus (A/New York/85/2001(H3N2)) s...  40.1    0.046
                        gb|CY000207.1|  Influenza A virus (A/New York/84/2001(H3N2)) s...  40.1    0.046
                        gb|CY000191.1|  Influenza A virus (A/New York/83/2001(H3N2)) s...  40.1    0.046
                        gb|CY000279.1|  Influenza A virus (A/New York/82/2001(H3N2)) s...  40.1    0.046
                        gb|CY001267.1|  Influenza A virus (A/New York/81/2002(H3N2)) s...  40.1    0.046
                        gb|CY000575.1|  Influenza A virus (A/New York/80/2001(H3N2)) s...  40.1    0.046
                        gb|CY001435.1|  Influenza A virus (A/New York/76/2002(H3N2)) s...  40.1    0.046
                        gb|CY001307.1|  Influenza A virus (A/New York/75/2002(H3N2)) s...  40.1    0.046
                        gb|CY001158.1|  Influenza A virus (A/New York/74/2002(H3N2)) s...  40.1    0.046
                        gb|CY000487.1|  Influenza A virus (A/New York/71/2001(H3N2)) s...  40.1    0.046
                        gb|CY001235.1|  Influenza A virus (A/New York/70/2004(H3N2)) s...  40.1    0.046
                        gb|CY000567.1|  Influenza A virus (A/New York/69/2004(H3N2)) s...  40.1    0.046
                        gb|CY000979.1|  Influenza A virus (A/New York/67/2003(H3N2)) s...  40.1    0.046
                        gb|CY001347.1|  Influenza A virus (A/New York/66/2003(H3N2)) s...  40.1    0.046
                        gb|CY001227.1|  Influenza A virus (A/New York/65/2003(H3N2)) s...  40.1    0.046
                        gb|CY000971.1|  Influenza A virus (A/New York/64/2003(H3N2)) s...  40.1    0.046
                        gb|CY001219.1|  Influenza A virus (A/New York/63/2003(H3N2)) s...  40.1    0.046
                        gb|CY000923.1|  Influenza A virus (A/New York/62A/2003(H3N2)) ...  40.1    0.046
                        gb|CY000007.1|  Influenza A virus (A/New York/61A/2003(H3N2)) ...  40.1    0.046
                        gb|CY000111.1|  Influenza A virus (A/New York/60A/2003(H3N2)) ...  40.1    0.046
                        gb|CY000963.1|  Influenza A virus (A/New York/59/2003(H3N2)) s...  40.1    0.046
                        gb|CY001518.1|  Influenza A virus (A/New York/58/2003(H3N2)) s...  40.1    0.046
                        gb|CY001211.1|  Influenza A virus (A/New York/56/2003(H3N2)) s...  40.1    0.046
                        gb|CY000955.1|  Influenza A virus (A/New York/55/2003(H3N2)) s...  40.1    0.046
                        gb|CY000103.1|  Influenza A virus (A/New York/54/2003(H3N2)) s...  40.1    0.046
                        gb|CY000271.1|  Influenza A virus (A/New York/53/2003(H3N2)) s...  40.1    0.046
                        gb|CY000263.1|  Influenza A virus (A/New York/52/2004(H3N2)) s...  40.1    0.046
                        gb|CY001070.1|  Influenza A virus (A/New York/51/2003(H3N2)) s...  40.1    0.046
                        gb|CY000095.1|  Influenza A virus (A/New York/50/2003(H3N2)) s...  40.1    0.046
                        gb|CY000383.1|  Influenza A virus (A/New York/49/2003(H3N2)) s...  40.1    0.046
                        gb|CY000087.1|  Influenza A virus (A/New York/48/2003(H3N2)) s...  40.1    0.046
                        gb|CY000079.1|  Influenza A virus (A/New York/47/2003(H3N2)) s...  40.1    0.046
                        gb|CY000791.1|  Influenza A virus (A/New York/46/2003(H3N2)) s...  40.1    0.046
                        gb|CY000071.1|  Influenza A virus (A/New York/45/2003(H3N2)) s...  40.1    0.046
                        gb|CY000183.1|  Influenza A virus (A/New York/44/2003(H3N2)) s...  40.1    0.046
                        gb|CY000175.1|  Influenza A virus (A/New York/43/2003(H3N2)) s...  40.1    0.046
                        gb|CY000167.1|  Influenza A virus (A/New York/42/2003(H3N2)) s...  40.1    0.046
                        gb|CY000159.1|  Influenza A virus (A/New York/41/2003(H3N2)) s...  40.1    0.046
                        gb|CY000151.1|  Influenza A virus (A/New York/40/2003(H3N2)) s...  40.1    0.046
                        gb|CY001102.1|  Influenza A virus (A/New York/39/2003(H3N2)) s...  40.1    0.046
                        gb|CY000783.1|  Influenza A virus (A/New York/38/2003(H3N2)) s...  40.1    0.046
                        gb|CY001299.1|  Influenza A virus (A/New York/37/2003(H3N2)) s...  40.1    0.046
                        gb|CY000063.1|  Influenza A virus (A/New York/36/2003(H3N2)) s...  40.1    0.046
                        gb|CY000055.1|  Influenza A virus (A/New York/35/2003(H3N2)) s...  40.1    0.046
                        gb|CY000047.1|  Influenza A virus (A/New York/34/2003(H3N2)) s...  40.1    0.046
                        gb|CY000039.1|  Influenza A virus (A/New York/33/2004(H3N2)) s...  40.1    0.046
                        gb|CY000375.1|  Influenza A virus (A/New York/31/2004(H3N2)) s...  40.1    0.046
                        gb|CY000527.1|  Influenza A virus (A/New York/29/2003(H3N2)) s...  40.1    0.046
                        gb|CY000015.1|  Influenza A virus (A/New York/28/2003(H3N2)) s...  40.1    0.046
                        gb|CY001118.1|  Influenza A virus (A/New York/27/2003(H3N2)) s...  40.1    0.046
                        gb|CY000143.1|  Influenza A virus (A/New York/26/2003(H3N2)) s...  40.1    0.046
                        gb|CY000775.2|  Influenza A virus (A/New York/25/2003(H3N2)) s...  40.1    0.046
                        gb|CY001094.1|  Influenza A virus (A/New York/24/2003(H3N2)) s...  40.1    0.046
                        gb|CY000199.1|  Influenza A virus (A/New York/23/2003(H3N2)) s...  40.1    0.046
                        gb|CY000367.1|  Influenza A virus (A/New York/22/2003(H3N2)) s...  40.1    0.046
                        gb|CY000359.1|  Influenza A virus (A/New York/21/2003(H3N2)) s...  40.1    0.046
                        gb|CY001427.1|  Influenza A virus (A/New York/20/2003(H3N2)) s...  40.1    0.046
                        gb|CY000256.3|  Influenza A virus (A/New York/19/2003(H3N2)) s...  40.1    0.046
                        gb|CY001195.1|  Influenza A virus (A/New York/18/2003(H3N2)) s...  40.1    0.046
                        gb|CY001059.1|  Influenza A virus (A/New York/17/2003(H3N2)) s...  40.1    0.046
                        gb|CY000135.1|  Influenza A virus (A/New York/16/2003(H3N2)) s...  40.1    0.046
                        gb|CY000351.1|  Influenza A virus (A/New York/15/2003(H3N2)) s...  40.1    0.046
                        gb|CY000915.1|  Influenza A virus (A/New York/14/2003(H3N2)) s...  40.1    0.046
                        gb|CY000907.1|  Influenza A virus (A/New York/13/2003(H3N2)) s...  40.1    0.046
                        gb|CY000127.1|  Influenza A virus (A/New York/12/2003(H3N2)) s...  40.1    0.046
                        gb|CY000518.1|  Influenza A virus (A/New York/11/2003(H3N2)) s...  40.1    0.046
                        gb|CY000767.1|  Influenza A virus (A/New York/10/2004(H3N2)) s...  40.1    0.046
                        gb|CY001291.1|  Influenza A virus (A/New York/9/2003(H3N2)) se...  40.1    0.046
                        gb|CY001051.1|  Influenza A virus (A/New York/8/2003(H3N2)) se...  40.1    0.046
                        gb|CY001043.1|  Influenza A virus (A/New York/7/2003(H3N2)) se...  40.1    0.046
                        gb|CY001035.1|  Influenza A virus (A/New York/6/2004(H3N2)) se...  40.1    0.046
                        gb|CY000895.1|  Influenza A virus (A/New York/5/2004(H3N2)) se...  40.1    0.046
                        gb|CY000511.1|  Influenza A virus (A/New York/4/2003(H3N2)) se...  40.1    0.046
                        gb|CY000887.1|  Influenza A virus (A/New York/3/2003(H3N2)) se...  40.1    0.046
                        gb|CY001027.1|  Influenza A virus (A/New York/1/2003(H3N2)) se...  40.1    0.046
                        gb|CY008546.1|  Influenza A virus (A/Canterbury/425/2003(H3N2)...  40.1    0.046
                        gb|CY008554.1|  Influenza A virus (A/Canterbury/426/2003(H3N2)...  40.1    0.046
                        gb|CY008754.1|  Influenza A virus (A/Canterbury/56/2000(H3N2))...  40.1    0.046
                        gb|CY008762.1|  Influenza A virus (A/Canterbury/68/2000(H3N2))...  40.1    0.046
                        gb|CY008770.1|  Influenza A virus (A/Canterbury/66/2000(H3N2))...  40.1    0.046
                        gb|CY008778.1|  Influenza A virus (A/Canterbury/71/2000(H3N2))...  40.1    0.046
                        gb|CY008810.1|  Influenza A virus (A/Canterbury/85/2000(H3N2))...  40.1    0.046
                        gb|CY008818.1|  Influenza A virus (A/Hutt/82/2000(H3N2)) segme...  40.1    0.046
                        gb|CY008826.1|  Influenza A virus (A/Canterbury/89/2000(H3N2))...  40.1    0.046
                        gb|CY008834.1|  Influenza A virus (A/Canterbury/93/2000(H3N2))...  40.1    0.046
                        gb|CY008842.1|  Influenza A virus (A/Canterbury/103/2000(H3N2)...  40.1    0.046
                        gb|CY008850.1|  Influenza A virus (A/Canterbury/101/2000(H3N2)...  40.1    0.046
                        gb|CY008858.1|  Influenza A virus (A/Canterbury/98/2000(H3N2))...  40.1    0.046
                        gb|CY008866.1|  Influenza A virus (A/Canterbury/90/2000(H3N2))...  40.1    0.046
                        gb|CY008986.1|  Influenza A virus (A/New York/550/1998(H3N2)) ...  40.1    0.046
                        gb|CY008922.1|  Influenza A virus (A/New York/479/2003(H3N2)) ...  40.1    0.046
                        gb|CY008930.1|  Influenza A virus (A/New York/504/1998(H3N2)) ...  40.1    0.046
                        gb|CY008938.1|  Influenza A virus (A/New York/507/1997(H3N2)) ...  40.1    0.046
                        gb|CY008946.1|  Influenza A virus (A/New York/514/1998(H3N2)) ...  40.1    0.046
                        gb|CY008954.1|  Influenza A virus (A/New York/529/1998(H3N2)) ...  40.1    0.046
                        gb|CY008962.1|  Influenza A virus (A/New York/530/1998(H3N2)) ...  40.1    0.046
                        gb|CY008970.1|  Influenza A virus (A/New York/540/1998(H3N2)) ...  40.1    0.046
                        gb|CY008978.1|  Influenza A virus (A/New York/549/1998(H3N2)) ...  40.1    0.046
                        gb|CY008538.1|  Influenza A virus (A/New York/544/1998(H3N2)) ...  40.1    0.046
                        gb|CY008874.1|  Influenza A Virus (A/New York/473/2003(H3N2)) ...  40.1    0.046
                        gb|CY008882.1|  Influenza A Virus (A/New York/474/2003(H3N2)) ...  40.1    0.046
                        gb|CY008890.1|  Influenza A Virus (A/New York/475/2003(H3N2)) ...  40.1    0.046
                        gb|CY008898.1|  Influenza A Virus (A/New York/476/2003(H3N2)) ...  40.1    0.046
                        gb|CY008914.1|  Influenza A Virus (A/New York/498/2004(H3N2)) ...  40.1    0.046
                        gb|AF400766.1|AF400766  Influenza A virus (A/Swine/Hong Kong/2...  40.1    0.046
                        gb|AF400765.1|AF400765  Influenza A virus (A/Swine/Hong Kong/2...  40.1    0.046
                        gb|AF400764.1|AF400764  Influenza A virus (A/Swine/Hong Kong/2...  40.1    0.046
                        gb|CY008202.1|  Influenza A virus (A/Canterbury/432/2003(H3N2)...  40.1    0.046
                        gb|CY008482.1|  Influenza A virus (A/Canterbury/17/2000(H3N2))...  40.1    0.046
                        gb|CY008490.1|  Influenza A virus (A/Canterbury/38/2000(H3N2))...  40.1    0.046
                        gb|CY008498.1|  Influenza A virus (A/Canterbury/73/2000(H3N2))...  40.1    0.046
                        gb|CY008514.1|  Influenza A virus (A/Canterbury/99/2000(H3N2))...  40.1    0.046
                        gb|CY008186.1|  Influenza A virus (A/New York/502/1998(H3N2)) ...  40.1    0.046
                        gb|CY008145.1|  Influenza A virus (A/Canterbury/39/2000(H3N2))...  40.1    0.046
                        gb|CY007945.1|  Influenza A virus (A/Canterbury/72/2002(H3N2))...  40.1    0.046
                        gb|CY005689.1|  Influenza A virus (A/duck/AUS/749/1980(H1N1)) ...  40.1    0.046
                        gb|CY001614.1|  Influenza A virus (A/New York/264/1999(H3N2)) ...  40.1    0.046
                        dbj|AB126634.1|  Influenza A virus (A/Yokohama/47/2002(H1N2)) ...  40.1    0.046
                        dbj|AB126625.1|  Influenza A virus (A/Yokohama/22/2002(H1N2)) ...  40.1    0.046
                        gb|AF225521.1|  Influenza A virus (A/sw/Shizuoka/120/97(H3N2))...  40.1    0.046
                        gb|AF225520.1|  Influenza A virus (A/sw/Shizuoka/119/97(H3N2))...  40.1    0.046
                        gb|AF225519.1|  Influenza A virus (A/sw/Shizuoka/115/97(H3N2))...  40.1    0.046
                        gb|AF225518.1|  Influenza A virus (A/sw/Shizuoka/110/97(H3N2))...  40.1    0.046
                        gb|CY008137.1|  Influenza A virus (A/Canterbury/42/2000(H3N2))...  40.1    0.046
                        gb|CY007833.1|  Influenza A virus (A/Canterbury/429/2003(H3N2)...  40.1    0.046
                        gb|CY007985.1|  Influenza A virus (A/New York/526/1997(H3N2)) ...  40.1    0.046
                        gb|CY007825.1|  Influenza A virus (A/Canterbury/409/2003(H3N2)...  40.1    0.046
                        gb|CY007641.1|  Influenza A virus (A/New York/326/1999(H3N2)) ...  40.1    0.046
                        gb|CY007753.1|  Influenza A virus (A/Canterbury/68/2002(H3N2))...  40.1    0.046
                        gb|CY006273.1|  Influenza A virus (A/New York/513/1997(H3N2)) ...  40.1    0.046
                        gb|CY006265.1|  Influenza A virus (A/New York/511/1997(H3N2)) ...  40.1    0.046
                        gb|CY006257.1|  Influenza A virus (A/New York/510/1998(H3N2)) ...  40.1    0.046
                        gb|CY007265.1|  Influenza A virus (A/Canterbury/443/2003(H3N2)...  40.1    0.046
                        gb|CY007257.1|  Influenza A virus (A/Canterbury/442/2003(H3N2)...  40.1    0.046
                        gb|CY007249.1|  Influenza A virus (A/Canterbury/441/2003(H3N2)...  40.1    0.046
                        gb|CY007241.1|  Influenza A virus (A/Canterbury/440/2003(H3N2)...  40.1    0.046
                        gb|CY007233.1|  Influenza A virus (A/Canterbury/439/2003(H3N2)...  40.1    0.046
                        gb|CY007225.1|  Influenza A virus (A/Canterbury/438/2003(H3N2)...  40.1    0.046
                        gb|CY007217.1|  Influenza A virus (A/Canterbury/437/2003(H3N2)...  40.1    0.046
                        gb|CY007201.1|  Influenza A virus (A/Canterbury/435/2003(H3N2)...  40.1    0.046
                        gb|CY007185.1|  Influenza A virus (A/South Canterbury/433/2003...  40.1    0.046
                        gb|CY007177.1|  Influenza A virus (A/Canterbury/431/2003(H3N2)...  40.1    0.046
                        gb|CY007161.1|  Influenza A virus (A/Canterbury/428/2003(H3N2)...  40.1    0.046
                        gb|CY007153.1|  Influenza A virus (A/Canterbury/427/2003(H3N2)...  40.1    0.046
                        gb|CY007113.1|  Influenza A virus (A/Canterbury/417/2003(H3N2)...  40.1    0.046
                        gb|CY007073.1|  Influenza A virus (A/Canterbury/408/2003(H3N2)...  40.1    0.046
                        gb|CY007033.1|  Influenza A virus (A/Canterbury/401/2003(H3N2)...  40.1    0.046
                        gb|CY007025.1|  Influenza A virus (A/Canterbury/399/2003(H3N2)...  40.1    0.046
                        gb|CY006953.1|  Influenza A virus (A/Canterbury/387/2003(H3N2)...  40.1    0.046
                        gb|CY007273.1|  Influenza A virus (A/Canterbury/444/2003(H3N2)...  40.1    0.046
                        gb|CY007193.1|  Influenza A virus (A/Canterbury/434/2003(H3N2)...  40.1    0.046
                        gb|CY007145.1|  Influenza A virus (A/Canterbury/424/2003(H3N2)...  40.1    0.046
                        gb|CY007137.1|  Influenza A virus (A/Canterbury/423/2003(H3N2)...  40.1    0.046
                        gb|CY007129.1|  Influenza A virus (A/Canterbury/420/2003(H3N2)...  40.1    0.046
                        gb|CY007121.1|  Influenza A virus (A/Canterbury/418/2003(H3N2)...  40.1    0.046
                        gb|CY007105.1|  Influenza A virus (A/Canterbury/416/2003(H3N2)...  40.1    0.046
                        gb|CY007097.1|  Influenza A virus (A/Canterbury/412/2003(H3N2)...  40.1    0.046
                        gb|CY007089.1|  Influenza A virus (A/Canterbury/411/2003(H3N2)...  40.1    0.046
                        gb|CY007081.1|  Influenza A virus (A/Canterbury/410/2003(H3N2)...  40.1    0.046
                        gb|CY007065.1|  Influenza A virus (A/Canterbury/406/2003(H3N2)...  40.1    0.046
                        gb|CY007057.1|  Influenza A virus (A/Canterbury/405/2003(H3N2)...  40.1    0.046
                        gb|CY007049.1|  Influenza A virus (A/Canterbury/404/2003(H3N2)...  40.1    0.046
                        gb|CY007041.1|  Influenza A virus (A/Canterbury/403/2003(H3N2)...  40.1    0.046
                        gb|CY007017.1|  Influenza A virus (A/Canterbury/398/2003(H3N2)...  40.1    0.046
                        gb|CY007009.1|  Influenza A virus (A/Canterbury/397/2003(H3N2)...  40.1    0.046
                        gb|CY007001.1|  Influenza A virus (A/Canterbury/395/2003(H3N2)...  40.1    0.046
                        gb|CY006993.1|  Influenza A virus (A/Canterbury/394/2003(H3N2)...  40.1    0.046
                        gb|CY006985.1|  Influenza A virus (A/Canterbury/393/2003(H3N2)...  40.1    0.046
                        gb|CY006977.1|  Influenza A virus (A/Canterbury/392/2003(H3N2)...  40.1    0.046
                        gb|CY006969.1|  Influenza A virus (A/Canterbury/391/2003(H3N2)...  40.1    0.046
                        gb|CY006961.1|  Influenza A virus (A/Canterbury/390/2003(H3N2)...  40.1    0.046
                        gb|CY006945.1|  Influenza A virus (A/Canterbury/386/2003(H3N2)...  40.1    0.046
                        gb|CY006937.1|  Influenza A virus (A/Canterbury/384/2003(H3N2)...  40.1    0.046
                        gb|CY006929.1|  Influenza A virus (A/Canterbury/382/2003(H3N2)...  40.1    0.046
                        gb|CY003775.1|  Influenza A virus (A/New York/417/2002(H1N2)) ...  40.1    0.046
                        gb|CY006905.1|  Influenza A virus (A/New York/460/1999(H3N2)) ...  40.1    0.046
                        gb|CY006809.1|  Influenza A virus (A/New York/538/1998(H3N2)) ...  40.1    0.046
                        gb|CY006801.1|  Influenza A virus (A/New York/527/1998(H3N2)) ...  40.1    0.046
                        gb|CY006793.1|  Influenza A virus (A/New York/506/1998(H3N2)) ...  40.1    0.046
                        gb|CY006777.1|  Influenza A virus (A/New York/535/1998(H3N2)) ...  40.1    0.046
                        gb|CY006401.1|  Influenza A virus (A/New York/487/2003(H1N2)) ...  40.1    0.046
                        gb|CY006393.1|  Influenza A virus (A/New York/481/2003(H1N2)) ...  40.1    0.046
                        gb|CY006665.1|  Influenza A virus (A/New York/435/2000(H3N2)) ...  40.1    0.046
                        gb|CY006537.1|  Influenza A virus (A/New York/525/1998(H3N2)) ...  40.1    0.046
                        gb|CY006625.1|  Influenza A virus (A/New York/546/1998(H3N2)) ...  40.1    0.046
                        gb|CY006641.1|  Influenza A virus (A/New York/548/1998(H3N2)) ...  40.1    0.046
                        gb|CY006633.1|  Influenza A virus (A/New York/547/1997(H3N2)) ...  40.1    0.046
                        gb|CY006617.1|  Influenza A virus (A/New York/545/1997(H3N2)) ...  40.1    0.046
                        gb|CY006609.1|  Influenza A virus (A/New York/543/1998(H3N2)) ...  40.1    0.046
                        gb|CY006601.1|  Influenza A virus (A/New York/542/1998(H3N2)) ...  40.1    0.046
                        gb|CY006593.1|  Influenza A virus (A/New York/541/1998(H3N2)) ...  40.1    0.046
                        gb|CY006569.1|  Influenza A virus (A/New York/533/1998(H3N2)) ...  40.1    0.046
                        gb|CY006561.1|  Influenza A virus (A/New York/532/1998(H3N2)) ...  40.1    0.046
                        gb|CY006553.1|  Influenza A virus (A/New York/531/1998(H3N2)) ...  40.1    0.046
                        gb|CY006529.1|  Influenza A virus (A/New York/524/1997(H3N2)) ...  40.1    0.046
                        gb|CY006521.1|  Influenza A virus (A/New York/523/1998(H3N2)) ...  40.1    0.046
                        gb|CY006513.1|  Influenza A virus (A/New York/522/1997(H3N2)) ...  40.1    0.046
                        gb|CY006585.1|  Influenza A virus (A/New York/539/1998(H3N2)) ...  40.1    0.046
                        gb|CY006577.1|  Influenza A virus (A/New York/534/1998(H3N2)) ...  40.1    0.046
                        gb|CY006505.1|  Influenza A virus (A/New York/521/1998(H3N2)) ...  40.1    0.046
                        gb|CY006545.1|  Influenza A virus (A/New York/528/1998(H3N2)) ...  40.1    0.046
                        gb|CY006497.1|  Influenza A virus (A/New York/520/1998(H3N2)) ...  40.1    0.046
                        gb|CY006489.1|  Influenza A virus (A/New York/519/1998(H3N2)) ...  40.1    0.046
                        gb|CY006481.1|  Influenza A virus (A/New York/518/1998(H3N2)) ...  40.1    0.046
                        gb|CY006457.1|  Influenza A virus (A/New York/509/1997(H3N2)) ...  40.1    0.046
                        gb|CY006449.1|  Influenza A virus (A/New York/501/1997(H3N2)) ...  40.1    0.046
                        gb|CY006473.1|  Influenza A virus (A/New York/516/1997(H3N2)) ...  40.1    0.046
                        gb|CY006465.1|  Influenza A virus (A/New York/512/1998(H3N2)) ...  40.1    0.046
                        gb|CY006281.1|  Influenza A virus (A/New York/515/1997(H3N2)) ...  40.1    0.046
                        gb|CY006249.1|  Influenza A virus (A/New York/508/1997(H3N2)) ...  40.1    0.046
                        gb|CY006233.1|  Influenza A virus (A/New York/503/1997(H3N2)) ...  40.1    0.046
                        gb|CY006289.1|  Influenza A virus (A/New York/517/1998(H3N2)) ...  40.1    0.046
                        gb|CY006241.1|  Influenza A virus (A/New York/505/1997(H3N2)) ...  40.1    0.046
                        emb|AJ306860.1|  Influenza A virus (A/swine/Finisterre/127/99(...  40.1    0.046
                        gb|AF037423.1|AF037423  Influenza A virus H3N2 A/Shiga/25/97 P...  40.1    0.046
                        gb|AF037422.1|AF037422  Influenza A virus H3N2 A/Fukushima/140...  40.1    0.046

                        Comment


                        • #13
                          Re: Tamiflu Resistant Pandemic H1N1 Sequence from Hunan China Released

                          PB2 travel log (PB2 is avian)

                          gb|GQ463197.1| Influenza A virus (A/Hunan/SWL3/2009(H1N1)) se... 38.2 0.18
                          gb|CY043331.1| Influenza A virus (A/Denmark/523/2009(H1N1)) s... 38.2 0.18
                          gb|CY040915.1| Influenza A virus (A/duck/Laos/P0117/2007(H5N1... 38.2 0.18
                          gb|EU146747.1| Influenza A virus (A/Indonesia/567H/2006(H5N1)... 38.2 0.18
                          gb|CY014520.1| Influenza A virus (A/Indonesia/CDC644/2006(H5N... 38.2 0.18
                          gb|CY014512.1| Influenza A virus (A/Indonesia/CDC644T/2006(H5... 38.2 0.18
                          gb|DQ492825.1| Influenza A virus (A/quail/Yogjakarta/BBVet-IX... 38.2 0.18
                          gb|DQ320866.1| Influenza A virus (A/chicken/Yogjakarta/BBVet-... 38.2 0.18
                          gb|AY737286.1| Influenza A virus (A/chicken/Guangdong/191/04(... 38.2 0.18

                          Comment


                          • #14
                            Re: Tamiflu Resistant Pandemic H1N1 Sequence from Hunan China Released

                            PB2

                            gb|CY044184.1| Influenza A virus (A/Silver Spring/SP510/2009(... 36.2 0.73
                            gb|CY044176.1| Influenza A virus (A/Silver Spring/SP509/2009(... 36.2 0.73
                            gb|CY044160.1| Influenza A virus (A/Mexico/48N/2009(H1N1)) se... 36.2 0.73
                            gb|CY044152.1| Influenza A virus (A/Managua/0536N/2009(H1N1))... 36.2 0.73
                            gb|CY044217.1| Influenza A virus (A/Taiwan/T1773/2009(H1N1)) ... 36.2 0.73
                            gb|CY044248.1| Influenza A virus (A/San Antonio/PR923/2009(H1... 36.2 0.73
                            gb|CY044240.1| Influenza A virus (A/San Antonio/PR922/2009(H1... 36.2 0.73
                            gb|CY044192.1| Influenza A virus (A/San Antonio/PR921/2009(H1... 36.2 0.73
                            gb|GQ463197.1| Influenza A virus (A/Hunan/SWL3/2009(H1N1)) se... 36.2 0.73
                            gb|CY044031.1| Influenza A virus (A/northern shoveler/Alaska/... 36.2 0.73
                            gb|CY044015.1| Influenza A virus (A/northern shoveler/Alaska/... 36.2 0.73
                            gb|CY043999.1| Influenza A virus (A/northern pintail/Alaska/7... 36.2 0.73
                            gb|CY043991.1| Influenza A virus (A/northern pintail/Alaska/7... 36.2 0.73
                            gb|CY043983.1| Influenza A virus (A/American widgeon/Alaska/7... 36.2 0.73
                            gb|CY043975.1| Influenza A virus (A/mallard/Alaska/7MP1028/20... 36.2 0.73
                            gb|CY043967.1| Influenza A virus (A/northern shoveler/Alaska/... 36.2 0.73
                            gb|CY043951.1| Influenza A virus (A/northern pintail/Alaska/7... 36.2 0.73
                            gb|CY043815.1| Influenza A virus (A/ring-necked duck/Californ... 36.2 0.73
                            gb|CY044127.1| Influenza A virus (A/New York/4197/2009(H1N1))... 36.2 0.73
                            gb|CY043935.1| Influenza A virus (A/shorebird/Delaware/472/20... 36.2 0.73
                            gb|CY043927.1| Influenza A virus (A/shorebird/Delaware/558/20... 36.2 0.73
                            gb|CY043919.1| Influenza A virus (A/shorebird/Delaware/249/20... 36.2 0.73
                            gb|CY043911.1| Influenza A virus (A/shorebird/Delaware/246/20... 36.2 0.73
                            gb|GQ455029.1| Influenza A virus (A/Nanjing/2/2009(H1N1)) seg... 36.2 0.73
                            gb|CY043759.1| Influenza A virus (A/Hong Kong/HKU49/2005(H3N2... 36.2 0.73
                            gb|CY043735.1| Influenza A virus (A/Siena/3/1991(H3N2)) segme... 36.2 0.73
                            gb|GQ433894.1| Influenza A virus (A/Jiangsu/1/2009(H1N1)) seg... 36.2 0.73
                            gb|CY043315.1| Influenza A virus (A/bald eagle/Virginia/Sg-00... 36.2 0.73
                            gb|CY043306.1| Influenza A virus (A/New York/3498/2009(H1N1))... 36.2 0.73
                            gb|CY043290.1| Influenza A virus (A/New York/3449/2009(H1N1))... 36.2 0.73
                            gb|CY043226.1| Influenza A virus (A/New York/3455/2009(H1N1))... 36.2 0.73
                            gb|CY043210.1| Influenza A virus (A/New York/3338/2009(H1N1))... 36.2 0.73
                            gb|CY043202.1| Influenza A virus (A/New York/3324/2009(H1N1))... 36.2 0.73
                            gb|CY042991.1| Influenza A virus (A/blue-winged teal/North Da... 36.2 0.73

                            Comment


                            • #15
                              Re: Tamiflu Resistant Pandemic H1N1 Sequence from Hunan China Released

                              PA trvel log

                              gb|GQ463199.1| Influenza A virus (A/Hunan/SWL3/2009(H1N1)) se... 46.1 0.002
                              gb|GQ258467.1| Influenza A virus (A/Auckland/1/2009(H1N1)) se... 46.1 0.002

                              Comment

                              Working...
                              X