Announcement

Collapse
No announcement yet.

Yamaguchi Japan Tamiflu Resistant Sequence Released

Collapse
X
  • Filter
  • Time
  • Show
Clear All
new posts

  • Yamaguchi Japan Tamiflu Resistant Sequence Released

    The sequence of a second example of H274Y in Japan has been released'

  • #2
    Re: Yamaguchi Japan Tamiflu Resistant Sequence Released

    LOCUS GQ397279 1410 bp cRNA linear VRL 21-JUL-2009
    DEFINITION Influenza A virus (A/Yamaguchi/22/2009(H1N1)) segment 6
    neuraminidase (NA) gene, complete cds.
    ACCESSION GQ397279
    VERSION GQ397279.1 GI:254548843
    DBLINK Project:37813
    KEYWORDS .
    SOURCE Influenza A virus (A/Yamaguchi/22/2009(H1N1))
    ORGANISM Influenza A virus (A/Yamaguchi/22/2009(H1N1))
    Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
    Influenzavirus A.
    REFERENCE 1 (bases 1 to 1410)
    AUTHORS Ujike,M., Obuchi,M., Tashiro,M., Horikawa,H., Kato,Y., Oguchi,A.,
    Fujita,N. and Odagiri,T.
    TITLE Human infection with novel swine H1N1 influenza
    JOURNAL Unpublished
    REFERENCE 2 (bases 1 to 1410)
    AUTHORS Toda,S. and Sirabe,S.
    TITLE Direct Submission
    JOURNAL Submitted (21-JUL-2009) Yamaguchi Prefectural Institute of Public
    Health and Environment, Yamagauchi, Japan
    REFERENCE 3 (bases 1 to 1410)
    AUTHORS Ujike,M., Obuchi,M., Tashiro,M. and Odagiri,T.
    TITLE Direct Submission
    JOURNAL Submitted (21-JUL-2009) National Institute of Infectious Diseases,
    4-7-1, Gakuen, Musashi-murayama, Tokyo 208-0011, Japan
    COMMENT Swine influenza A (H1N1) virus isolated during human swine flu
    outbreak of 2009.
    FEATURES Location/Qualifiers
    source 1..1410
    /organism="Influenza A virus (A/Yamaguchi/22/2009(H1N1))"
    /mol_type="viral cRNA"
    /strain="A/Yamaguchi/22/2009"
    /serotype="H1N1"
    /host="Homo sapiens"
    /db_xref="taxon:660652"
    /segment="6"
    /country="Japan"
    /collection_date="2009"
    /note="lineage: swl; passage history: MDCK2; resistance to
    oseltamivir"
    gene 1..1410
    /gene="NA"
    CDS 1..1410
    /gene="NA"
    /codon_start=1
    /product="neuraminidase"
    /protein_id="ACT67256.1"
    /db_xref="GI:254548844"
    /translation="MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHS IQLGNQN
    QIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPV SGWAIYSK
    DNSIRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDR SPYRTLMS
    CPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNG IITDTIKS
    WRNNILRTQESECACVNGSCFTVMTDGPSDGQASYKIFRIEKGKIVKSVE MNAPNYYY
    EECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNP RPNDKTGS
    CGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTD NNFSIKQD
    IVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSS ISFCGVNS
    DTVGWSWPDGAELPFTIDK"
    ORIGIN
    1 atgaatccaa accaaaagat aataaccatt ggttcggtct gtatgacaat tggaatggct
    61 aacttaatat tacaaattgg aaacataatc tcaatatgga ttagccactc aattcaactt
    121 gggaatcaaa atcagattga aacatgcaat caaagcgtca ttacttatga aaacaacact
    181 tgggtaaatc agacatatgt taacatcagc aacaccaact ttgctgctgg acagtcagtg
    241 gtttccgtga aattagcggg caattcctct ctctgccctg ttagtggatg ggctatatac
    301 agtaaagaca acagtataag aatcggttcc aagggggatg tgtttgtcat aagggaacca
    361 ttcatatcat gctccccctt ggaatgcaga accttcttct tgactcaagg ggccttgcta
    421 aatgacaaac attccaatgg aaccattaaa gacaggagcc catatcgaac cctaatgagc
    481 tgtcctattg gtgaagttcc ctctccatac aactcaagat ttgagtcagt cgcttggtca
    541 gcaagtgctt gtcatgatgg catcaattgg ctaacaattg gaatttctgg cccagacaat
    601 ggggcagtgg ctgtgttaaa gtacaacggc ataataacag acactatcaa gagttggaga
    661 aacaatatat tgagaacaca agagtctgaa tgtgcatgtg taaatggttc ttgctttact
    721 gtaatgaccg atggaccaag tgatggacag gcctcataca aaatcttcag aatagaaaag
    781 ggaaagatag tcaaatcagt cgaaatgaat gcccctaatt attactatga ggaatgctcc
    841 tgttatcctg attctagtga aatcacatgt gtgtgcaggg ataactggca tggctcgaat
    901 cgaccgtggg tgtctttcaa ccagaatctg gaatatcaga taggatacat atgcagtggg
    961 attttcggag acaatccacg ccctaatgat aagacaggca gttgtggtcc agtatcgtct
    1021 aatggagcaa atggagtaaa aggattttca ttcaaatacg gcaatggtgt ttggataggg
    1081 agaactaaaa gcattagttc aagaaacggt tttgagatga tttgggatcc gaacggatgg
    1141 actgggacag acaataactt ctcaataaag caagatatcg taggaataaa tgagtggtca
    1201 ggatatagcg ggagttttgt tcagcatcca gaactaacag ggctggattg tataagacct
    1261 tgcttctggg ttgaactaat cagagggcga cccaaagaga acacaatctg gactagcggg
    1321 agcagcatat ccttttgtgg tgtaaacagt gacactgtgg gttggtcttg gccagacggt
    1381 gctgagttgc catttaccat tgacaagtaa

    Comment


    • #3
      Re: Yamaguchi Japan Tamiflu Resistant Sequence Released

      So does this, coupled with the quebec resistance, indicate that there is a circulating strain with H274Y?

      Comment


      • #4
        Re: Yamaguchi Japan Tamiflu Resistant Sequence Released

        Originally posted by Rwilmer View Post
        So does this, coupled with the quebec resistance, indicate that there is a circulating strain with H274Y?
        The circumstances surrounding this sequence are unclear. The Quebec sequence appears to be from a contact taking a prophylactic dose of Tamiflu. This sequence has H274Y and it is assumed that the Quebec sequence also has H274Y, but on a different genetic background.

        Comment


        • #5
          Re: Yamaguchi Japan Tamiflu Resistant Sequence Released

          Originally posted by Rwilmer View Post
          So does this, coupled with the quebec resistance, indicate that there is a circulating strain with H274Y?
          The Quebec case seems to imply infection from a family member. We would need at least a sequence from the family member who may have been the source of the older man's infection. But there is the question being raised in that thread: did the man with the known resistant strain spread it?
          Wotan (pronounced Voton with the ton rhyming with on) - The German Odin, ruler of the Aesir.

          I am not a doctor, virologist, biologist, etc. I am a layman with a background in the physical sciences.

          Attempting to blog an nascent pandemic: Diary of a Flu Year

          Comment


          • #6
            Re: Yamaguchi Japan Tamiflu Resistant Sequence Released

            NA travel log

            gb|GQ368668.1| Influenza A virus (A/Distrito Federal/2611/200... 34.2 2.9
            gb|GQ365427.1| Influenza A virus (A/Iwate/1/2009(H1N1)) segme... 34.2 2.9
            gb|GQ365412.1| Influenza A virus (A/Akita/1/2009(H1N1)) segme... 34.2 2.9
            gb|GQ334348.1| Influenza A virus (A/Shizuoka/759/2009(H1N1)) ... 34.2 2.9
            gb|CY041760.1| Influenza A virus (A/New York/3413/2009(H1N1))... 34.2 2.9
            gb|GQ287628.1| Influenza A virus (A/Yokohama/1/2009(H1N1)) se... 34.2 2.9
            gb|GQ287624.1| Influenza A virus (A/Shiga/3/2009(H1N1)) segme... 34.2 2.9
            gb|GQ225351.1| Influenza A virus (A/Zhejiang/1/2009(H1N1)) se... 34.2 2.9
            gb|DQ432046.1| Influenza A virus (A/swine/Fujian/2003(H5N1)) ... 34.2 2.9
            gb|DQ432038.1| Influenza A virus (A/swine/Fujian/2001(H5N1)) ... 34.2 2.9
            gb|AY651473.2| Influenza A virus (A/teal/China/2978.1/2002(H5... 34.2 2.9
            gb|AY575883.2| Influenza A virus (A/Gs/HK/739.2/02 (H5N1)) ne... 34.2 2.9
            gb|CY029169.1| Influenza A virus (A/quail/Shantou/3846/2002(H... 34.2 2.9
            gb|CY029120.1| Influenza A virus (A/goose/Shantou/157/2002(H5... 34.2 2.9
            gb|CY029085.1| Influenza A virus (A/duck/Shantou/5526/2001(H5... 34.2 2.9
            gb|EF541469.1| Influenza A virus (A/Hong Kong/213/2003(H5N1))... 34.2 2.9
            gb|EF541468.1| Influenza A virus (A/chicken/Viet Nam/Ncvd8/20... 34.2 2.9
            gb|EF541465.1| Influenza A virus (A/duck/Viet Nam/Ncvd1/2002(... 34.2 2.9
            gb|EF467813.1| Influenza A virus (A/teal/Hong Kong/2978/03(H5... 34.2 2.9
            gb|EF124325.1| Influenza A virus (A/goose/Shantou/3624/2006(H... 34.2 2.9
            gb|EF124312.1| Influenza A virus (A/goose/Shantou/2086/2006(H... 34.2 2.9
            gb|EF124311.1| Influenza A virus (A/goose/Shantou/239/2006(H5... 34.2 2.9
            gb|DQ997385.1| Influenza A virus (A/swine/Anhui/ca/2004(H5N1)... 34.2 2.9
            gb|DQ997411.1| Influenza A virus (A/duck/Zhejiang/bj/2002(H5N... 34.2 2.9
            gb|DQ997397.1| Influenza A virus (A/chicken/Hunan/fg/2004(H5N... 34.2 2.9
            gb|DQ997183.1| Influenza A virus (A/chicken/Jiangsu/cz1/2002(... 34.2 2.9
            gb|DQ191691.1| Influenza A virus (A/golden mountain thrush/Fu... 34.2 2.9
            gb|DQ191690.1| Influenza A virus (A/curlew/Shandong/61/04(H5N... 34.2 2.9
            gb|DQ188911.1| Influenza A virus (A/black bulbul/Fujian/439/0... 34.2 2.9
            gb|DQ188910.1| Influenza A virus (A/slaty-backed gull/Shandon... 34.2 2.9
            gb|DQ188909.1| Influenza A virus (A/babbler/Fujian/320/04(H5N... 34.2 2.9
            gb|AY623431.1| Influenza A virus (A/chicken/Yichang/lung-1/04... 34.2 2.9
            gb|AY747610.2| Influenza A virus (A/swine/Fujian/1/2003(H5N1)... 34.2 2.9
            gb|AY747618.1| Influenza A virus (A/swine/Fujian/F1/2001(H5N1... 34.2 2.9
            gb|AY585419.1| Influenza A virus (A/duck/Zhejiang/52/2000(H5N... 34.2 2.9
            gb|AY575884.1| Influenza A virus (A/Eg/HK/757.3/02 (H5N1)) ne... 34.2 2.9
            gb|AY575882.1| Influenza A virus (A/HK/213/03 (H5N1)) neurami... 34.2 2.9
            gb|AY575881.1| Influenza A virus (A/HK/212/03 (H5N1)) neurami... 34.2 2.9
            gb|DQ321057.1| Influenza A virus (A/Chinese pond heron/Hong K... 34.2 2.9
            gb|DQ321055.1| Influenza A virus (A/grey heron/Hong Kong/728/... 34.2 2.9
            gb|DQ321026.1| Influenza A virus (A/chicken/Guangxi/2448/2004... 34.2 2.9
            gb|DQ321025.1| Influenza A virus (A/chicken/Guangxi/2439/2004... 34.2 2.9
            gb|DQ321024.1| Influenza A virus (A/duck/Guangxi/2396/2004(H5... 34.2 2.9
            gb|DQ321023.1| Influenza A virus (A/goose/Guangxi/2383/2004(H... 34.2 2.9
            gb|DQ321022.1| Influenza A virus (A/duck/Guangxi/2291/2004(H5... 34.2 2.9
            gb|DQ321021.1| Influenza A virus (A/goose/Guangxi/2112/2004(H... 34.2 2.9
            gb|DQ321020.1| Influenza A virus (A/goose/Guangxi/1832/2004(H... 34.2 2.9
            gb|DQ321019.1| Influenza A virus (A/duck/Guangxi/1793/2004(H5... 34.2 2.9
            gb|DQ321018.1| Influenza A virus (A/duck/Guangxi/1681/2004(H5... 34.2 2.9
            gb|DQ321017.1| Influenza A virus (A/duck/Guangxi/1586/2004(H5... 34.2 2.9
            gb|DQ321016.1| Influenza A virus (A/duck/Guangxi/1378/2004(H5... 34.2 2.9
            gb|DQ321015.1| Influenza A virus (A/duck/Guangxi/1311/2004(H5... 34.2 2.9
            gb|DQ321014.1| Influenza A virus (A/goose/Guangxi/1198/2004(H... 34.2 2.9
            gb|DQ321013.1| Influenza A virus (A/goose/Guangxi/1097/2004(H... 34.2 2.9
            gb|DQ321012.1| Influenza A virus (A/goose/Guangxi/914/2004(H5... 34.2 2.9
            gb|DQ321011.1| Influenza A virus (A/goose/Guangxi/668/2004(H5... 34.2 2.9
            dbj|AB212056.1| Influenza A virus (A/Hong Kong/213/2003(H5N1)... 34.2 2.9
            dbj|AB212282.1| Influenza A virus (A/duck/Yokohama/aq10/2003(... 34.2 2.9
            gb|AY676042.1| Influenza A virus (A/egret/Hong Kong/757.2/03(... 34.2 2.9

            Comment


            • #7
              Re: Yamaguchi Japan Tamiflu Resistant Sequence Released

              Do all the sequences in the NA travel log have H274Y?

              .
              "The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation

              Comment


              • #8
                Re: Yamaguchi Japan Tamiflu Resistant Sequence Released

                Since there is no New Jersey in that travel log, can we assume it is not the same NA as the 274Y-infected HK girl flying from San Francisco?

                .
                "The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation

                Comment


                • #9
                  Re: Yamaguchi Japan Tamiflu Resistant Sequence Released

                  Originally posted by AlaskaDenise View Post
                  Do all the sequences in the NA travel log have H274Y?

                  .
                  No, all of the sequences in the travel log have a recently acquired polymorphism found in Yamaguchi/22.

                  Comment


                  • #10
                    Re: Yamaguchi Japan Tamiflu Resistant Sequence Released

                    Originally posted by AlaskaDenise View Post
                    Since there is no New Jersey in that travel log, can we assume it is not the same NA as the 274Y-infected HK girl flying from San Francisco?

                    .
                    Correct. This is H274Y on a different genetic background than the Hong Kong / San Francisco sequence or the Osaka sequence. The sequences from Denmark and Quebec have not been released.

                    Thus, at this time H274Y is on five isolates and no evidence has been presented to show that any of the five match each other.

                    Comment


                    • #11
                      Re: Yamaguchi Japan Tamiflu Resistant Sequence Released

                      Originally posted by niman View Post
                      ........at this time H274Y is on five isolates and no evidence has been presented to show that any of the five match each other.
                      There shouldn't be any doubt influenza knows what it's doing.

                      .
                      "The next major advancement in the health of American people will be determined by what the individual is willing to do for himself"-- John Knowles, Former President of the Rockefeller Foundation

                      Comment


                      • #12
                        Re: Yamaguchi Japan Tamiflu Resistant Sequence Released

                        Today, June 2nd, the first case of H1N1 influenza was confirmed in Yamaguchi Prefecture.
                        We are taking all possible measures as a prefecture in order to prevent the spread of infection, so we ask that everyone please act in a calm manner and act based upon accurate information.

                        http://www.pref.yamaguchi.lg.jp/cms/...ntmessage.html

                        Comment


                        • #13
                          Re: Yamaguchi Japan Tamiflu Resistant Sequence Released

                          A PDF (in English) for each confirmed case in Yamaguchi is here

                          http://www.pref.yamaguchi.lg.jp/cms/...infection.html

                          None listed developed H1N1 while on Tamiflu.

                          Comment


                          • #14
                            Re: Yamaguchi Japan Tamiflu Resistant Sequence Released

                            Niman,
                            Thanks for that link. They did a good job of including details on the patients; I wish more reports were like that.
                            The salvage of human life ought to be placed above barter and exchange ~ Louis Harris, 1918

                            Comment


                            • #15
                              Re: Yamaguchi Japan Tamiflu Resistant Sequence Released

                              Originally posted by mixin View Post
                              Niman,
                              Thanks for that link. They did a good job of including details on the patients; I wish more reports were like that.
                              I think Japan and Hong Kong provide that type of detail (at least on the initial cases).

                              Comment

                              Working...
                              X